Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675023
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): UROC1
Proper citation: Atlas Antibodies Cat# HPA036254, RRID:AB_2675023 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732677
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RC3H2
Proper citation: Atlas Antibodies Cat# HPA062144, RRID:AB_2732677 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796238
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): ANGPTL6 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA041171, RRID:AB_10796238 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10001196
Comments: Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Host Organism: Rabbit
Clonality polyclonal
Target(s): GAP-43
Proper citation: Novus Cat# NB300-143, RRID:AB_10001196 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859459
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF804B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026702, RRID:AB_1859459 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847587
Comments: Vendor recommendations: Western Blot; Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): DECR1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023238, RRID:AB_1847587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671841
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM53A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036452, RRID:AB_10671841 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_203285
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): Diaphanous 1
Proper citation: Bethyl Cat# A300-077A, RRID:AB_203285 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078606
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): CCNK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000645, RRID:AB_1078606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845191
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP6V0D1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA016938, RRID:AB_1845191 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848782
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TRMT61B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026747, RRID:AB_1848782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1850498
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): HAPLN1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019482, RRID:AB_1850498 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078146
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): AMN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000817, RRID:AB_1078146 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602082
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PRKD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029529, RRID:AB_10602082 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10954105
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF316
Proper citation: Thermo Fisher Scientific Cat# A303-249A, RRID:AB_10954105 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2088298
Comments: validation status unknown check with seller; recommendations: WB, IF, IHC(P); Immunohistochemistry; Western Blot; Immunocytochemistry; Immunofluorescence
Host Organism: mouse
Clonality monoclonal
Target(s): SDF-1 (P-159X)
Proper citation: Santa Cruz Biotechnology Cat# sc-74271, RRID:AB_2088298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671865
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): EYA4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038771, RRID:AB_10671865 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2144271
Comments: Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Neutralization, Knockout Validated
Host Organism: Mouse
Clonality monoclonal
Target(s): MMP-1
Proper citation: R and D Systems Cat# MAB901, RRID:AB_2144271 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844298
Comments: Vendor recommendations: IgG1kappa indirect ELISA: suitable, immunoblotting: suitable; Western Blot; ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): ZNF277 antibody produced in mouse
Proper citation: Sigma-Aldrich Cat# WH0011179M1, RRID:AB_1844298 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_310102
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: sheep
Clonality polyclonal
Target(s): ATF1
Proper citation: Millipore Cat# 06-325, RRID:AB_310102 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
