Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684903
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CD164L2
Proper citation: Atlas Antibodies Cat# HPA062915, RRID:AB_2684903 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683270
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXD1
Proper citation: Atlas Antibodies Cat# HPA056900, RRID:AB_2683270 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684423
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA0895
Proper citation: Atlas Antibodies Cat# HPA061066, RRID:AB_2684423 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679444
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NSL1
Proper citation: Atlas Antibodies Cat# HPA045761, RRID:AB_2679444 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683189
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF526
Proper citation: Atlas Antibodies Cat# HPA056609, RRID:AB_2683189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683715
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LIX1
Proper citation: Atlas Antibodies Cat# HPA058426, RRID:AB_2683715 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684196
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBL1Y
Proper citation: Atlas Antibodies Cat# HPA060073, RRID:AB_2684196 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080581
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): WAS
Proper citation: Sigma-Aldrich Cat# HPA002022, RRID:AB_1080581 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080282
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): HAVCR1
Proper citation: Atlas Antibodies Cat# HPA007173, RRID:AB_1080282 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1731041
Comments: Discontinued; Applications: IP (5-10 µg/mg lysate), IHC (1:500-1:2,000), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): ARID2
Proper citation: Thermo Fisher Scientific Cat# A302-230A, RRID:AB_1731041 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732722
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ZNF184
Proper citation: Atlas Antibodies Cat# HPA064793, RRID:AB_2732722 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601584
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KPNA7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031395, RRID:AB_10601584 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685502
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC9B1
Proper citation: Atlas Antibodies Cat# HPA065520, RRID:AB_2685502 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680126
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PLEKHH1
Proper citation: Atlas Antibodies Cat# HPA047707, RRID:AB_2680126 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599307
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TKT
Proper citation: Atlas Antibodies Cat# HPA029480, RRID:AB_10599307 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1215920
Comments: manufacturer recommendations: IgG WB; ELISA; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615122, AB_1215920.
Host Organism: rabbit
Clonality polyclonal
Target(s): SFRS6 (splicing factor arginine/serine-rich 6) (against the middle region of SFRS6) (50ug)
Proper citation: Aviva Systems Biology Cat# ARP40632_P050, RRID:AB_1215920 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854818
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): OSMR
Proper citation: Atlas Antibodies Cat# HPA017278, RRID:AB_1854818 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078122
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human AKAP8
Proper citation: Sigma-Aldrich Cat# HPA004776, RRID:AB_1078122 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856088
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human URB1
Proper citation: Sigma-Aldrich Cat# HPA018334, RRID:AB_1856088 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697090
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): TRPC3
Proper citation: Atlas Antibodies Cat# HPA037969, RRID:AB_10697090 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.