Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-GLRA4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044759, RRID:AB_10795885 GLRA4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795885 Atlas Antibodies HPA044759 2025-08-19 05:18:33 0
Anti-PKD2L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041903, RRID:AB_2677734 PKD2L2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677734 Atlas Antibodies HPA041903 2025-08-19 05:18:56 0
Anti-NICN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037550, RRID:AB_10672599 NICN1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTP; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10672599 Atlas Antibodies HPA037550 2025-08-19 05:18:33 0
Anti-ELP6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064545, RRID:AB_2685282 ELP6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685282 Atlas Antibodies HPA064545 2025-08-19 05:18:56 0
Anti-HDGF
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048728, RRID:AB_2680503 HDGF human Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680503 Atlas Antibodies HPA048728 2025-08-19 05:18:56 0
H3K4me2-celegans
 
Resource Report
Resource Website
Rating or validation data
Agilent Cat# 308-34809, RRID:AB_2616535 H3K4me2 caenorhabditis elegans ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data unknown mouse AB_2616535 Agilent 308-34809 (also ENCAB420YAH) 2025-08-19 05:18:32 0
Anti-TRA2B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064972, RRID:AB_2685396 TRA2B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685396 Atlas Antibodies HPA064972 2025-08-19 05:18:56 0
Anti-ZNF277 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027307, RRID:AB_1859164 ZNF277 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1859164 Atlas Antibodies HPA027307 2025-08-19 05:18:55 0
Anti-SRL
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041535, RRID:AB_2677538 SRL human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2677538 Atlas Antibodies HPA041535 2025-08-19 05:18:56 0
Anti-FBXL17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036410, RRID:AB_2675109 FBXL17 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675109 Atlas Antibodies HPA036410 2025-08-19 05:18:56 0
ZNF385A-human
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039799, RRID:AB_10795117 ZNF385A human polyclonal rabbit AB_10795117 Atlas Antibodies HPA039799 2025-08-19 05:19:06 0
Anti-ZNF620 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059383, RRID:AB_2732636 ZNF620 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732636 Atlas Antibodies HPA059383 2025-08-19 05:19:02 0
Anti-DNALI1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA028305, RRID:AB_10601807 DNALI1 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601807 Sigma-Aldrich HPA028305 2025-08-19 05:22:17 2
Anti-GDF15 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA011191, RRID:AB_1078962 GDF15 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1078962 Sigma-Aldrich HPA011191 2025-08-19 05:21:56 1
CD 15, galactoside 3-L-fucosyltransferase
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Ventana Medical Systems Cat# 760-2504, RRID:AB_2335952 ND [MMA] Used By NYUIHC-158
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2335952 Ventana Medical Systems 760-2504 2025-08-19 05:22:31 2
TBK1 antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Proteintech Cat# 28397-1-AP, RRID:AB_2881132 TBK1 mouse, human Applications: WB, IHC, ELISA
Originating manufacturer of this product.
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.5061682
polyclonal rabbit AB_2881132 Proteintech 28397-1-AP 2025-08-19 05:22:03 4
Anti-FNTA antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018830, RRID:AB_1848992 FNTA antibody produced in rabbit human Vendor recommendations: Other; Immunofluorescence; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1848992 Sigma-Aldrich HPA018830 2025-08-19 05:22:01 0
Anti-MSL1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA023567, RRID:AB_1853059 Human MSL1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1853059 Sigma-Aldrich HPA023567 2025-08-19 05:22:10 0
PDX1 antibody
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Abcam Cat# ab47383, RRID:AB_2162359 PDX1 mouse, human validation status unknown, seller recommendations provided in 2012:immunohistochemistry, immunocytochemistry polyclonal goat AB_2162359 Abcam ab47383 2025-08-19 05:22:16 14
Anti-MYO9A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040071, RRID:AB_10961117 MYO9A antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961117 Sigma-Aldrich HPA040071 2025-08-19 06:00:30 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.