Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-ARL15 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044604, RRID:AB_10960542 | ARL15 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10960542 | Sigma-Aldrich | HPA044604 | 2025-08-19 05:21:40 | 0 | |||
|
SGLT2/SLC5A2 Antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Novus Cat# NBP1-92384, RRID:AB_11027910 | SGLT2/SLC5A2 | Human, Tenrec, Canine, Mouse |
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE NYUIHC-1452 |
polyclonal | Rabbit | AB_11027910 | Novus | NBP1-92384 (also NBP1-92384-25ul) | 2025-08-19 05:21:43 | 2 | ||
|
Anti-SPG7 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044447, RRID:AB_10966216 | SPG7 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10966216 | Sigma-Aldrich | HPA044447 | 2025-08-19 05:21:40 | 0 | |||
|
Anti-ANXA1 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA011271, RRID:AB_1844883 | ANXA1 | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1844883 | Atlas Antibodies | HPA011271 | 2025-08-19 05:21:36 | 1 | ||
|
RPS3A-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX105020, RRID:AB_1951765 | RPS3A | rat, mouse, human | ENCODE PROJECT External validation DATA SET is released testing lot 39953 for not specified; status is awaiting lab characterization | polyclonal | rabbit | AB_1951765 | GeneTex | GTX105020 | 2025-08-19 05:21:43 | 0 | ||
|
Opioid Receptor-Mu (MOR) Antibody Resource Report Resource Website 50+ mentions Rating or validation data |
ImmunoStar Cat# 24216, RRID:AB_572251 | Synthetic rat MOR1 (384-398) | tadpole, chicken, monkey, rat, mouse, starling, frog, cat, human |
PMID:10218804 PMID:9175900 PMID:25807259 PMID:9593869 PMID:9169542 PMID:9622672 PMID:10439458 PMID:10366629 PMID:26098212 PMID:9804311 |
Manufacturer Applications: Immunohistochemistry, Immunocytochemistry, Immunofluoresence, Western Blot; Note, The Mu Opioid Receptor antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat caudate putamen and spinal cord (dorsal horn) using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/500 - 1/1000 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/6000 - 1/10000 in PBS/0.3% Triton X-100 - Biotin/avidin-HRP Technique. Preadsorption with MOR peptide (384-398) at 10 µg/ml completely eliminates labeling. The specificity of the antiserum was determined by immunolabeling of transfected cells, Western Blot analysis and immunoisolation studies.; Gene Symbol: | polyclonal | rabbit | AB_572251 | ImmunoStar | 24216 | 2025-08-19 05:25:26 | 75 | |
|
Rabbit anti-API5 Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A302-784A, RRID:AB_10630605 | API5 | mouse, human | Applications: WB, IP, IHC | polyclonal | rabbit | AB_10630605 | Bethyl | A302-784A (also A302-784A-M, A302-784A-T) | 2025-08-19 05:25:39 | 0 | ||
|
Anti-NHLRC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038493, RRID:AB_10672519 | NHLRC2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10672519 | Atlas Antibodies | HPA038493 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-PCK2 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA053502, RRID:AB_2682171 | PCK2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2682171 | Atlas Antibodies | HPA053502 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-AKR1B1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA026425, RRID:AB_10601563 | AKR1B1 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601563 | Atlas Antibodies | HPA026425 | 2025-08-19 05:25:41 | 0 | ||
|
Anti-SGCA Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA007537, RRID:AB_1079944 | SGCA | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1079944 | Atlas Antibodies | HPA007537 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-WAPL Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037875, RRID:AB_10672396 | WAPL | human | Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10672396 | Atlas Antibodies | HPA037875 | 2025-08-19 05:25:41 | 0 | ||
|
DPF1-human Resource Report Resource Website Rating or validation data |
CDI Cat# R1172.1.1B3, RRID:AB_2615905 | DPF1 | Homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot 20141119.LRH for not specified; status is not pursued | unknown | mouse | AB_2615905 | CDI | R1172.1.1B3 (also ENCAB759KXE) | 2025-08-19 05:26:08 | 0 | ||
|
Anti-METTL10 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA050138, RRID:AB_2681030 | METTL10 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2681030 | Atlas Antibodies | HPA050138 | 2025-08-19 05:25:42 | 0 | ||
|
Anti-METAP1D Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA030299, RRID:AB_10602421 | METAP1D | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10602421 | Atlas Antibodies | HPA030299 | 2025-08-19 05:25:41 | 0 | ||
|
Anti-YEATS4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA072532, RRID:AB_2686530 | YEATS4 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686530 | Atlas Antibodies | HPA072532 | 2025-08-19 05:25:42 | 0 | ||
|
Anti-USF3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA029243, RRID:AB_10611114 | USF3 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10611114 | Atlas Antibodies | HPA029243 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-FUNDC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA059129, RRID:AB_2683915 | FUNDC2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683915 | Atlas Antibodies | HPA059129 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-LOXL3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035281, RRID:AB_10601766 | LOXL3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCP; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10601766 | Atlas Antibodies | HPA035281 | 2025-08-19 05:26:09 | 0 | ||
|
Anti-COL7A1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA042420, RRID:AB_2677990 | COL7A1 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2677990 | Atlas Antibodies | HPA042420 | 2025-08-19 05:25:42 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
