Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1843734
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 12027-4A5 for any cell type or tissues; status is awaiting lab characterization
Host Organism: mouse
Clonality monoclonal
Target(s): SPDEF
Proper citation: Sigma-Aldrich Cat# WH0025803M1, RRID:AB_1843734 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078449
Comments: Rated by ISCC, Intestinal Stem Cell Consortium (check ratings https://iscc.coh.org/)
Host Organism:
Clonality unknown
Target(s): CD166
Proper citation: Sigma-Aldrich Cat# HPA010926, RRID:AB_1078449 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2271535
Comments: manufacturer recommendations: ELISA; Western Blot; ELISA (titre 1:312500), Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615120, AB_2271535.
Host Organism: rabbit
Clonality polyclonal
Target(s): SYNCRIP
Proper citation: Aviva Systems Biology Cat# ARP40641_T100, RRID:AB_2271535 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683516
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CYP11B2
Proper citation: Atlas Antibodies Cat# HPA057752, RRID:AB_2683516 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682740
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USP35
Proper citation: Atlas Antibodies Cat# HPA055213, RRID:AB_2682740 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670918
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C14orf80
Proper citation: Atlas Antibodies Cat# HPA039050, RRID:AB_10670918 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603460
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WFS1
Proper citation: Atlas Antibodies Cat# HPA029128, RRID:AB_10603460 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683799
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): OSBPL5
Proper citation: Atlas Antibodies Cat# HPA058727, RRID:AB_2683799 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674386
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SLC1A4
Proper citation: Atlas Antibodies Cat# HPA034964, RRID:AB_2674386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686223
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SEC23B
Proper citation: Atlas Antibodies Cat# HPA069974, RRID:AB_2686223 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857069
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC28A3
Proper citation: Atlas Antibodies Cat# HPA024729, RRID:AB_1857069 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795885
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GLRA4
Proper citation: Atlas Antibodies Cat# HPA044759, RRID:AB_10795885 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677734
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PKD2L2
Proper citation: Atlas Antibodies Cat# HPA041903, RRID:AB_2677734 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672599
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTP; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): NICN1
Proper citation: Atlas Antibodies Cat# HPA037550, RRID:AB_10672599 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685282
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ELP6
Proper citation: Atlas Antibodies Cat# HPA064545, RRID:AB_2685282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680503
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HDGF
Proper citation: Atlas Antibodies Cat# HPA048728, RRID:AB_2680503 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616535
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: mouse
Clonality unknown
Target(s): H3K4me2
Proper citation: Agilent Cat# 308-34809, RRID:AB_2616535 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685396
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRA2B
Proper citation: Atlas Antibodies Cat# HPA064972, RRID:AB_2685396 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859164
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF277
Proper citation: Atlas Antibodies Cat# HPA027307, RRID:AB_1859164 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677538
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SRL
Proper citation: Atlas Antibodies Cat# HPA041535, RRID:AB_2677538 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.