Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-VHL polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031631, RRID:AB_2673968 VHL human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2673968 Atlas Antibodies HPA031631 2025-08-19 05:39:12 0
Anti-MAGI3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA008444, RRID:AB_2668069 MAGI3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2668069 Atlas Antibodies HPA008444 2025-08-19 05:39:11 0
Anti-PROX1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001030, RRID:AB_2666177 PROX1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2666177 Atlas Antibodies HPA001030 2025-08-19 05:39:11 0
Anti-DPP7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059381, RRID:AB_2683999 DPP7 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683999 Atlas Antibodies HPA059381 2025-08-19 05:39:12 0
SRSF3-human
 
Resource Report
Resource Website
Rating or validation data
Aviva Systems Biology Cat# ARP40438_P050, RRID:AB_2047958 SRSF3 homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot QC11166 for not specified; status is awaiting lab characterization; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615146, AB_2047958. unknown rabbit AB_2047958 Aviva Systems Biology ARP40438_P050 (also ENCAB000AXB) 2025-08-19 05:39:22 0
Anti-UROC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036254, RRID:AB_2675023 UROC1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC polyclonal rabbit AB_2675023 Atlas Antibodies HPA036254 2025-08-19 05:39:26 0
Anti-RC3H2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062144, RRID:AB_2732677 RC3H2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732677 Atlas Antibodies HPA062144 2025-08-19 05:39:16 0
Anti-ANGPTL6 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041171, RRID:AB_10796238 ANGPTL6 antibody produced in rabbit human polyclonal rabbit AB_10796238 Atlas Antibodies HPA041171 2025-08-19 05:39:33 0
GAP-43 Antibody
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Novus Cat# NB300-143, RRID:AB_10001196 GAP-43 Human, Porcine, Rat, Bovine, Drosophila, Canine, Mouse, Primate, Chicken, Equine Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen polyclonal Rabbit AB_10001196 Novus NB300-143 (also NB300-143SS) 2025-08-19 05:39:37 11
Anti-RAD54L2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035004, RRID:AB_10671930 RAD54L2 antibody produced in rabbit human polyclonal rabbit AB_10671930 Atlas Antibodies HPA035004 2025-08-19 05:38:29 0
Anti-RPS15
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA057793, RRID:AB_2683528 RPS15 human unknown rabbit AB_2683528 Sigma-Aldrich HPA057793 2025-08-19 05:38:26 0
Anti-WIBG antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA046200, RRID:AB_10965556 WIBG antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10965556 Sigma-Aldrich HPA046200 2025-08-19 05:38:41 0
Anti-IFT80 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035868, RRID:AB_10959463 IFT80 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10959463 Atlas Antibodies HPA035868 2025-08-19 05:38:36 0
Anti-CD34 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA036722, RRID:AB_2675271 CD34 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675271 Atlas Antibodies HPA036722 2025-08-19 05:36:34 1
Rabbit anti-PNUTS Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A300-439A, RRID:AB_420948 PNUTS human Applications: WB, IP, IHC
Original Manufacturer
polyclonal rabbit AB_420948 Bethyl A300-439A (also A300-439A-T, A300-439A-M) 2025-08-19 05:36:32 5
Anti-MASTL polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA027175, RRID:AB_1853591 MASTL human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1853591 Atlas Antibodies HPA027175 2025-08-19 05:36:35 2
Anti-PASK antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA016450, RRID:AB_1854992 PASK antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other polyclonal rabbit AB_1854992 Sigma-Aldrich HPA016450 2025-08-19 05:36:44 0
Anti-TTC26 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036338, RRID:AB_10673351 TTC26 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673351 Atlas Antibodies HPA036338 2025-08-19 05:37:23 0
Anti-SOX6 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001923, RRID:AB_1080065 SOX6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080065 Atlas Antibodies HPA001923 2025-08-19 05:36:51 1
Anti-HES6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061763, RRID:AB_2684604 HES6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684604 Atlas Antibodies HPA061763 2025-08-19 05:37:24 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.