Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_572251
Comments: Manufacturer Applications: Immunohistochemistry, Immunocytochemistry, Immunofluoresence, Western Blot; Note, The Mu Opioid Receptor antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat caudate putamen and spinal cord (dorsal horn) using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/500 - 1/1000 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/6000 - 1/10000 in PBS/0.3% Triton X-100 - Biotin/avidin-HRP Technique. Preadsorption with MOR peptide (384-398) at 10 µg/ml completely eliminates labeling. The specificity of the antiserum was determined by immunolabeling of transfected cells, Western Blot analysis and immunoisolation studies.; Gene Symbol:
Host Organism: rabbit
Clonality polyclonal
Target(s): Synthetic rat MOR1 (384-398)
Proper citation: ImmunoStar Cat# 24216, RRID:AB_572251 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10630605
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): API5
Proper citation: Bethyl Cat# A302-784A, RRID:AB_10630605 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672519
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NHLRC2
Proper citation: Atlas Antibodies Cat# HPA038493, RRID:AB_10672519 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682171
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PCK2
Proper citation: Atlas Antibodies Cat# HPA053502, RRID:AB_2682171 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601563
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AKR1B1
Proper citation: Atlas Antibodies Cat# HPA026425, RRID:AB_10601563 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079944
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SGCA
Proper citation: Atlas Antibodies Cat# HPA007537, RRID:AB_1079944 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672396
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): WAPL
Proper citation: Atlas Antibodies Cat# HPA037875, RRID:AB_10672396 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615905
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20141119.LRH for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): DPF1
Proper citation: CDI Cat# R1172.1.1B3, RRID:AB_2615905 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681030
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): METTL10
Proper citation: Atlas Antibodies Cat# HPA050138, RRID:AB_2681030 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602421
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): METAP1D
Proper citation: Atlas Antibodies Cat# HPA030299, RRID:AB_10602421 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686530
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): YEATS4
Proper citation: Atlas Antibodies Cat# HPA072532, RRID:AB_2686530 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611114
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USF3
Proper citation: Atlas Antibodies Cat# HPA029243, RRID:AB_10611114 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683915
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUNDC2
Proper citation: Atlas Antibodies Cat# HPA059129, RRID:AB_2683915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601766
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCP; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): LOXL3
Proper citation: Atlas Antibodies Cat# HPA035281, RRID:AB_10601766 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677990
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL7A1
Proper citation: Atlas Antibodies Cat# HPA042420, RRID:AB_2677990 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686880
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXA2
Proper citation: Atlas Antibodies Cat# HPA078220, RRID:AB_2686880 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079386
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MIPOL1
Proper citation: Atlas Antibodies Cat# HPA002893, RRID:AB_1079386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795259
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC83 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA039707, RRID:AB_10795259 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684704
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): TPD52
Proper citation: Sigma-Aldrich Cat# HPA062167, RRID:AB_2684704 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857783
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TAX1BP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024432, RRID:AB_1857783 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
