Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080572
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGQYYLQICALLKCQTTDLETCGEPVGSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDPPRLGQGSGKFQ; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): VNN3
Proper citation: Atlas Antibodies Cat# HPA010818, RRID:AB_1080572 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603239
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SERINC2
Proper citation: Atlas Antibodies Cat# HPA005974, RRID:AB_10603239 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2218842
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF20
Proper citation: Atlas Antibodies Cat# HPA020887, RRID:AB_2218842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844724
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ALDH1B1
Proper citation: Atlas Antibodies Cat# HPA021037, RRID:AB_1844724 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079583
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PCSK6
Proper citation: Atlas Antibodies Cat# HPA004774, RRID:AB_1079583 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_242534
Comments: Applications: WB, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): BHC110/LSD1
Proper citation: Bethyl Cat# A300-216A, RRID:AB_242534 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683785
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EIF4E3
Proper citation: Atlas Antibodies Cat# HPA058649, RRID:AB_2683785 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602350
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MDP1
Proper citation: Atlas Antibodies Cat# HPA003064, RRID:AB_10602350 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855558
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNJ3
Proper citation: Atlas Antibodies Cat# HPA024231, RRID:AB_1855558 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620374
Comments: Applications: IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): IRF8
Proper citation: Bethyl Cat# A304-026A, RRID:AB_2620374 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671836
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): THUMPD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036170, RRID:AB_10671836 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686320
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NDC1
Proper citation: Atlas Antibodies Cat# HPA070882, RRID:AB_2686320 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681623
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): BCAS1
Proper citation: Atlas Antibodies Cat# HPA051816, RRID:AB_2681623 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680962
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SRRM1
Proper citation: Atlas Antibodies Cat# HPA049941, RRID:AB_2680962 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670818
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGQEDYLPSSTVERRSSDGVRTQVTEAKNGMRPGTESTEKERNKGAVNVGGQDPEPGQDLSQPEREVDPSWGRGREPRLGKLRFQNDPLSV; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): DENND2A
Proper citation: Atlas Antibodies Cat# HPA021778, RRID:AB_2670818 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683864
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATAD3B
Proper citation: Atlas Antibodies Cat# HPA058968, RRID:AB_2683864 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677706
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EPS8L1
Proper citation: Atlas Antibodies Cat# HPA041851, RRID:AB_2677706 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848395
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PIEZO2
Proper citation: Atlas Antibodies Cat# HPA015986, RRID:AB_1848395 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673301
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ANKRD12
Proper citation: Atlas Antibodies Cat# HPA040705, RRID:AB_10673301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672065
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): GAA
Proper citation: Sigma-Aldrich Cat# HPA026970, RRID:AB_2672065 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.