Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686544
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEI; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): SMG5
Proper citation: Atlas Antibodies Cat# HPA072651, RRID:AB_2686544 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960411
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP126
Proper citation: Atlas Antibodies Cat# HPA045904, RRID:AB_10960411 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686270
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNJ9
Proper citation: Atlas Antibodies Cat# HPA070478, RRID:AB_2686270 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963060
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): FAM159A
Proper citation: Atlas Antibodies Cat# HPA030744, RRID:AB_10963060 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686488
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HES7
Proper citation: Atlas Antibodies Cat# HPA072105, RRID:AB_2686488 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682407
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): IDH3B
Proper citation: Sigma-Aldrich Cat# HPA054180, RRID:AB_2682407 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10604096
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SNRNP200
Proper citation: Atlas Antibodies Cat# HPA029321, RRID:AB_10604096 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079721
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRELID1
Proper citation: Atlas Antibodies Cat# HPA005701, RRID:AB_1079721 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847808
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): DNER antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017320, RRID:AB_1847808 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844336
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): YWHAE
Proper citation: Atlas Antibodies Cat# HPA008445, RRID:AB_1844336 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681807
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CD38
Proper citation: Atlas Antibodies Cat# HPA052381, RRID:AB_2681807 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079148
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human IRF4
Proper citation: Sigma-Aldrich Cat# HPA002038, RRID:AB_1079148 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805706
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM39B
Proper citation: Atlas Antibodies Cat# HPA040191, RRID:AB_10805706 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_627648
Comments: validation status unknown check with seller; recommendations: Immunofluorescence; Immunohistochemistry; Immunocytochemistry; ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Western Blot
Host Organism: mouse
Clonality monoclonal
Target(s): GABP-alpha (H-2)
Proper citation: Santa Cruz Biotechnology Cat# sc-28311, RRID:AB_627648 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2131015
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KLHL6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024512, RRID:AB_2131015 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079086
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human C22orf31
Proper citation: Sigma-Aldrich Cat# HPA000604, RRID:AB_1079086 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2270079
Comments: validation status unknown, seller recommendations provided in 2012: ELISA; Immunohistochemistry; Immunohistochemistry - fixed; Western Blot; ELISA, IHC-P, WB
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): alpha 1 Antitrypsin antibody [B9]
Proper citation: Abcam Cat# ab9399, RRID:AB_2270079 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_442810
Comments: Applications: Immunohistochemistry - frozen; Immunocytochemistry; Western Blot; Immunofluorescence; Flow Cytometry; Immunohistochemistry; Immunohistochemistry - fixed; Flow Cyt, ICC/IF, IHC-Fr, IHC-P, WB
Info: Used by Czech Centre for Phenogenomics
Host Organism: rabbit
Clonality polyclonal
Target(s): CD45 antibody
Proper citation: Abcam Cat# ab10558, RRID:AB_442810 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2134886
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): LANCL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA005470, RRID:AB_2134886 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844915
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): ANAPC11 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021989, RRID:AB_1844915 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.