Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Integrin beta 4
 
Resource Report
Resource Website
Rating or validation data
Millipore Cat# CBL545, RRID:AB_2335666 ND [439-9B] Used By NYUIHC-371
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rat AB_2335666 Millipore CBL545 2025-08-19 05:29:41 0
Anti-ELOVL7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036337, RRID:AB_10670797 ELOVL7 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670797 Atlas Antibodies HPA036337 2025-08-19 05:29:48 0
Anti-SHROOM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037691, RRID:AB_2675614 SHROOM1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675614 Atlas Antibodies HPA037691 2025-08-19 05:29:46 0
Anti-VSIG4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003903, RRID:AB_1858776 VSIG4 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1858776 Atlas Antibodies HPA003903 2025-08-19 05:29:48 0
Anti-PRSS22 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049161, RRID:AB_2680660 PRSS22 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680660 Atlas Antibodies HPA049161 2025-08-19 05:29:47 0
Anti-WIPF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA070706, RRID:AB_2686300 WIPF1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686300 Atlas Antibodies HPA070706 2025-08-19 05:29:50 0
Anti-NBEAL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049447, RRID:AB_2680771 NBEAL1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680771 Atlas Antibodies HPA049447 2025-08-19 05:29:49 0
Anti-FUT8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040863, RRID:AB_2677174 FUT8 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677174 Atlas Antibodies HPA040863 2025-08-19 05:29:49 0
Anti-TTC33
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038252, RRID:AB_10674551 TTC33 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10674551 Atlas Antibodies HPA038252 2025-08-19 05:29:49 0
NOPP140 Antibody
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A302-185A, RRID:AB_1659829 NOPP140 human Discontinued; Applications: IP (5-15 µg/mg lysate), WB (1:2,000-1:10,000) polyclonal rabbit AB_1659829 Thermo Fisher Scientific A302-185A 2025-08-19 05:30:04 0
Human CD31/PECAM-1 Antibody
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
R and D Systems Cat# AF806, RRID:AB_355617 CD31/PECAM-1 Human Applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry, Knockout Validated polyclonal Sheep AB_355617 R and D Systems AF806 (also AF806-SP) 2025-08-19 05:30:19 17
Human/Mouse Pax3/Pax7 Antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
R and D Systems Cat# MAB2457, RRID:AB_2159398 Pax3/Pax7 Human, Mouse 274212 Applications: Western Blot, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready monoclonal Mouse AB_2159398 R and D Systems MAB2457 (also MAB2457-SP) 2025-08-19 05:30:17 4
Anti-TMEM87A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018189, RRID:AB_2205198 TMEM87A human Useful for immunohistochemistry polyclonal rabbit AB_2205198 Sigma-Aldrich HPA018189 2025-08-19 05:44:02 0
Anti-TMCC3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA014272, RRID:AB_1858059 TMCC3 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1858059 Sigma-Aldrich HPA014272 2025-08-19 05:44:02 0
Brg-1 (G-7)
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Santa Cruz Biotechnology Cat# sc-17796, RRID:AB_626762 SMARCA4 rat, mouse, human G-7 validation status unknown check with seller; recommendations: ELISA; Immunocytochemistry; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, Immunohistochemistry(P), ELISA monoclonal mouse AB_626762 Santa Cruz Biotechnology sc-17796 2025-08-19 05:44:26 25
Anti-POLR1E polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA022527, RRID:AB_1854924 POLR1E human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854924 Atlas Antibodies HPA022527 2025-08-19 05:44:17 0
Anti-PPP1R12B
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024171, RRID:AB_1854266 PPP1R12B human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1854266 Atlas Antibodies HPA024171 2025-08-19 05:44:28 0
Anti-VNN3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA010818, RRID:AB_1080572 VNN3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGQYYLQICALLKCQTTDLETCGEPVGSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDPPRLGQGSGKFQ; Manufacturer approved use: IHC polyclonal rabbit AB_1080572 Atlas Antibodies HPA010818 2025-08-19 05:44:46 0
Anti-SERINC2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA005974, RRID:AB_10603239 SERINC2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603239 Atlas Antibodies HPA005974 2025-08-19 05:44:48 0
Anti-ZNF20 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020887, RRID:AB_2218842 ZNF20 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2218842 Atlas Antibodies HPA020887 2025-08-19 05:44:48 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.