Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335666
Comments: Used By NYUIHC-371
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rat
Clonality monoclonal
Target(s): ND
Proper citation: Millipore Cat# CBL545, RRID:AB_2335666 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670797
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ELOVL7
Proper citation: Atlas Antibodies Cat# HPA036337, RRID:AB_10670797 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675614
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SHROOM1
Proper citation: Atlas Antibodies Cat# HPA037691, RRID:AB_2675614 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858776
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VSIG4
Proper citation: Atlas Antibodies Cat# HPA003903, RRID:AB_1858776 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680660
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRSS22
Proper citation: Atlas Antibodies Cat# HPA049161, RRID:AB_2680660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686300
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): WIPF1
Proper citation: Atlas Antibodies Cat# HPA070706, RRID:AB_2686300 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680771
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NBEAL1
Proper citation: Atlas Antibodies Cat# HPA049447, RRID:AB_2680771 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677174
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUT8
Proper citation: Atlas Antibodies Cat# HPA040863, RRID:AB_2677174 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10674551
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TTC33
Proper citation: Atlas Antibodies Cat# HPA038252, RRID:AB_10674551 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1659829
Comments: Discontinued; Applications: IP (5-15 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): NOPP140
Proper citation: Thermo Fisher Scientific Cat# A302-185A, RRID:AB_1659829 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_355617
Comments: Applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry, Knockout Validated
Host Organism: Sheep
Clonality polyclonal
Target(s): CD31/PECAM-1
Proper citation: R and D Systems Cat# AF806, RRID:AB_355617 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2159398
Comments: Applications: Western Blot, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready
Host Organism: Mouse
Clonality monoclonal
Target(s): Pax3/Pax7
Proper citation: R and D Systems Cat# MAB2457, RRID:AB_2159398 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2205198
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM87A
Proper citation: Sigma-Aldrich Cat# HPA018189, RRID:AB_2205198 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858059
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TMCC3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014272, RRID:AB_1858059 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_626762
Comments: validation status unknown check with seller; recommendations: ELISA; Immunocytochemistry; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, Immunohistochemistry(P), ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): SMARCA4
Proper citation: Santa Cruz Biotechnology Cat# sc-17796, RRID:AB_626762 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854924
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): POLR1E
Proper citation: Atlas Antibodies Cat# HPA022527, RRID:AB_1854924 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854266
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PPP1R12B
Proper citation: Atlas Antibodies Cat# HPA024171, RRID:AB_1854266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080572
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGQYYLQICALLKCQTTDLETCGEPVGSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDPPRLGQGSGKFQ; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): VNN3
Proper citation: Atlas Antibodies Cat# HPA010818, RRID:AB_1080572 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603239
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SERINC2
Proper citation: Atlas Antibodies Cat# HPA005974, RRID:AB_10603239 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2218842
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF20
Proper citation: Atlas Antibodies Cat# HPA020887, RRID:AB_2218842 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.