Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 260 showing 5181 ~ 5200 out of 55,391 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684564

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIF4A

Proper citation: Atlas Antibodies Cat# HPA061583, RRID:AB_2684564 Copy   


  • RRID:AB_1848145

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848145

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): EML2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA012757, RRID:AB_1848145 Copy   


  • RRID:AB_10601909

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601909

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): LPO antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA028688, RRID:AB_10601909 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2090925

Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): DDX46

Proper citation: Bethyl Cat# A301-052A, RRID:AB_2090925 Copy   


  • RRID:AB_2110381

    This resource has 10+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2110381

Comments: Originating manufacturer of this product.
Applications: WB, IP, IHC, IF, ELISA
Used By NYUIHC-1086
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): KGA/GAC

Proper citation: Proteintech Cat# 12855-1-AP, RRID:AB_2110381 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849334

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GPR149

Proper citation: Atlas Antibodies Cat# HPA018020, RRID:AB_1849334 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845757

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human C7orf30

Proper citation: Sigma-Aldrich Cat# HPA020487, RRID:AB_1845757 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854338

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human NDOR1

Proper citation: Sigma-Aldrich Cat# HPA024504, RRID:AB_1854338 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2204904

Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM200A

Proper citation: Sigma-Aldrich Cat# HPA014396, RRID:AB_2204904 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847173

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human CROT

Proper citation: Sigma-Aldrich Cat# HPA019364, RRID:AB_1847173 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844576

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human ADAM2

Proper citation: Sigma-Aldrich Cat# HPA024621, RRID:AB_1844576 Copy   


  • RRID:AB_1079243

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079243

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LDLR

Proper citation: Atlas Antibodies Cat# HPA009647, RRID:AB_1079243 Copy   


  • RRID:AB_1078194

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078194

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ARHGAP1

Proper citation: Atlas Antibodies Cat# HPA004689, RRID:AB_1078194 Copy   


  • RRID:AB_1846205

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846205

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CCT8

Proper citation: Atlas Antibodies Cat# HPA021051, RRID:AB_1846205 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079468

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NRXN3

Proper citation: Atlas Antibodies Cat# HPA002727, RRID:AB_1079468 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078312

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM213A

Proper citation: Atlas Antibodies Cat# HPA009025, RRID:AB_1078312 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079577

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PCDHGA2

Proper citation: Atlas Antibodies Cat# HPA008755, RRID:AB_1079577 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601028

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPAAVHPFH; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZBED2

Proper citation: Atlas Antibodies Cat# HPA029786, RRID:AB_10601028 Copy   


  • RRID:AB_2674146

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2674146

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KAZN

Proper citation: Atlas Antibodies Cat# HPA032095, RRID:AB_2674146 Copy   


  • RRID:AB_10671583

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671583

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NEK1

Proper citation: Atlas Antibodies Cat# HPA020873, RRID:AB_10671583 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X