Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
UBTF-human
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Santa Cruz Biotechnology Cat# sc-13125, RRID:AB_671403 UBTF homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot B1804 for K562,HeLa-S3,GM12878,HepG2; status is awaiting lab characterization monoclonal mouse AB_671403 Santa Cruz Biotechnology sc-13125 2025-08-19 06:38:58 14
Anti-NUP107 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024141, RRID:AB_1854710 NUP107 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAP; Manufacturer approved use: IHC polyclonal rabbit AB_1854710 Atlas Antibodies HPA024141 2025-08-19 06:39:05 0
Anti-USH1C antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA027492, RRID:AB_10601898 USH1C antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601898 Sigma-Aldrich HPA027492 2025-08-19 06:38:56 0
Anti-GMFB antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA002954, RRID:AB_1078997 Human GMFB human Vendor recommendations: unknown rabbit AB_1078997 Sigma-Aldrich HPA002954 2025-08-19 06:39:03 1
DKK1 (D5V6L) Rabbit mAb
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Cell Signaling Technology Cat# 48367, RRID:AB_2799337 DKK1 h Clone D5V6L Applications: W, IP, IF-IC
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rabbit AB_2799337 Cell Signaling Technology 48367 2025-08-19 06:39:15 2
Anti-LMO1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA011369, RRID:AB_1852957 LMO1 human polyclonal rabbit AB_1852957 Atlas Antibodies HPA011369 2025-08-19 06:39:17 0
Anti-SPARC antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002989, RRID:AB_1079532 Human SPARC human Vendor recommendations: unknown rabbit AB_1079532 Sigma-Aldrich HPA002989 2025-08-19 06:39:24 0
H4K91ac-human
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Abcam Cat# ab4627, RRID:AB_304538 H4K91ac homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 82963 for any cell type or tissues; status is awaiting lab characterization polyclonal rabbit AB_304538 Abcam ab4627 2025-08-19 06:40:43 2
Phospho-Cofilin (Ser3) (77G2) Rabbit mAb
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Cell Signaling Technology Cat# 3313, RRID:AB_2080597 Cfl1 rat, mouse, human Applications: W, IF-IC. Consolidation on 11/2018: AB_10140374, AB_10140711, AB_10140916, AB_2080597, AB_2244926. Info: Used By NYUIHC-700.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rabbit AB_2080597 Cell Signaling Technology 3313 2025-08-19 06:40:38 43
08-15D6
 
Resource Report
Resource Website
Rating or validation data
New York University; New York; USA Cat# TW004, RRID:AB_2335841 ND [08-15D6] Used By NYUIHC-1346
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2335841 New York University; New York; USA TW004 2025-08-19 06:41:01 0
Anti-PRIM2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA046566, RRID:AB_2679701 PRIM2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679701 Atlas Antibodies HPA046566 2025-08-19 06:41:07 0
Anti-CUL5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA002185, RRID:AB_1078587 CUL5 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078587 Atlas Antibodies HPA002185 2025-08-19 06:41:06 0
Anti-C22orf31
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000604, RRID:AB_1079086 C22orf31 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1079086 Atlas Antibodies HPA000604 2025-08-19 06:41:11 0
Anti-DDX46
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036554, RRID:AB_10673621 DDX46 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10673621 Atlas Antibodies HPA036554 2025-08-19 06:41:12 0
Anti-IGF2BP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035145, RRID:AB_2674491 IGF2BP2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674491 Atlas Antibodies HPA035145 2025-08-19 06:41:06 0
Anti-SLC35D3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030431, RRID:AB_10601716 SLC35D3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601716 Atlas Antibodies HPA030431 2025-08-19 06:41:11 0
Anti-UBE2J1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003509, RRID:AB_1858531 UBE2J1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1858531 Atlas Antibodies HPA003509 2025-08-19 06:41:11 0
Anti-VPS18
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040701, RRID:AB_10794145 VPS18 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794145 Atlas Antibodies HPA040701 2025-08-19 06:41:07 0
Anti-GUK1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048587, RRID:AB_2680453 GUK1 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680453 Atlas Antibodies HPA048587 2025-08-19 06:41:07 0
Anti-IAPP polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA053194, RRID:AB_2682076 IAPP human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682076 Atlas Antibodies HPA053194 2025-08-19 06:41:07 1

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.