Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-RAB11B polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA054396, RRID:AB_2682474 RAB11B human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682474 Atlas Antibodies HPA054396 2025-08-19 07:47:18 1
Anti-SIRT6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA071776, RRID:AB_2686445 SIRT6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686445 Atlas Antibodies HPA071776 2025-08-19 07:47:10 0
Anti-BOD1L1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041290, RRID:AB_2677393 BOD1L1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677393 Atlas Antibodies HPA041290 2025-08-19 07:47:17 0
Anti-GRXCR1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040824, RRID:AB_10794863 GRXCR1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794863 Atlas Antibodies HPA040824 2025-08-19 07:47:17 0
Anti-COL19A1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042422, RRID:AB_10794798 COL19A1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794798 Atlas Antibodies HPA042422 2025-08-19 07:47:17 0
Anti-ZNF662 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039116, RRID:AB_2676355 ZNF662 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676355 Atlas Antibodies HPA039116 2025-08-19 07:47:17 0
Anti-KRT20
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027236, RRID:AB_1852224 KRT20 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1852224 Atlas Antibodies HPA027236 2025-08-19 07:47:17 0
Anti-CASKIN2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA065308, RRID:AB_2685461 CASKIN2 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2685461 Atlas Antibodies HPA065308 2025-08-19 07:47:09 0
Anti-AFMID polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA026536, RRID:AB_1844637 AFMID human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRY; Manufacturer approved use: IHC, WB polyclonal rabbit AB_1844637 Atlas Antibodies HPA026536 2025-08-19 07:47:08 0
Anti-MESDC2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041721, RRID:AB_2756310 human Originating manufacturer of this product. Applications: WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2756310 Atlas Antibodies HPA041721 2025-08-19 07:47:12 0
Anti-CPEB1
 
Resource Report
Resource Website
Rating or validation data
MBL International Cat# RN038P, RRID:AB_10597874 CPEB1 human manufacturer recommendations: Radioimmunoassay; Immunoprecipitation; Western Blot; WB, IPP, RIP unknown rabbit AB_10597874 MBL International RN038P 2025-08-19 07:47:54 0
Human HGF Antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
R and D Systems Cat# AF-294-NA, RRID:AB_354451 HGF Human Applications: Western Blot, Immunohistochemistry, Neutralization polyclonal Goat AB_354451 R and D Systems AF-294-NA (also AF-294-SP) 2025-08-19 07:47:52 1
Anti-FMN2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA004937, RRID:AB_1848961 FMN2 human polyclonal rabbit AB_1848961 Atlas Antibodies HPA004937 2025-08-19 07:47:59 0
Anti-RBM7 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA013993, RRID:AB_1856137 Human RBM7 human Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1856137 Sigma-Aldrich HPA013993 2025-08-19 07:47:52 6
Anti-C17orf69 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA021630, RRID:AB_1845600 Human C17orf69 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1845600 Sigma-Aldrich HPA021630 2025-08-19 07:47:52 0
Anti-NRK antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA017238, RRID:AB_1854645 Human NRK human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1854645 Sigma-Aldrich HPA017238 2025-08-19 07:40:11 0
Anti-MTERF antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044894, RRID:AB_10966284 MTERF antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10966284 Sigma-Aldrich HPA044894 2025-08-19 07:40:44 0
Anti-HS2ST1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043603, RRID:AB_10963432 HS2ST1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10963432 Sigma-Aldrich HPA043603 2025-08-19 07:40:44 0
Anti-USP10
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA006731, RRID:AB_1080495 USP10 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1080495 Atlas Antibodies HPA006731 2025-08-19 07:40:55 2
Rabbit anti-SUPT5H Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A300-869A, RRID:AB_609484 SUPT5H human Applications: WB, IP, IHC
Original Manufacturer
polyclonal rabbit AB_609484 Bethyl A300-869A (also A300-869A-T, A300-869A-M) 2025-08-19 07:40:59 1

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.