Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685484
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SIVA1
Proper citation: Atlas Antibodies Cat# HPA065398, RRID:AB_2685484 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685811
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): NCR2
Proper citation: Atlas Antibodies Cat# HPA067249, RRID:AB_2685811 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685954
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ANKH
Proper citation: Atlas Antibodies Cat# HPA068104, RRID:AB_2685954 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686162
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CEACAM7
Proper citation: Atlas Antibodies Cat# HPA069621, RRID:AB_2686162 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680479
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CBX6
Proper citation: Atlas Antibodies Cat# HPA048653, RRID:AB_2680479 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795635
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TFAM antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040648, RRID:AB_10795635 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686158
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GRPR
Proper citation: Atlas Antibodies Cat# HPA069604, RRID:AB_2686158 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677961
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MC5R
Proper citation: Atlas Antibodies Cat# HPA042365, RRID:AB_2677961 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668214
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP7B
Proper citation: Atlas Antibodies Cat# HPA009137, RRID:AB_2668214 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683267
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF444
Proper citation: Atlas Antibodies Cat# HPA056895, RRID:AB_2683267 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682784
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATP6V0D2
Proper citation: Atlas Antibodies Cat# HPA055327, RRID:AB_2682784 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682525
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TRIM52
Proper citation: Atlas Antibodies Cat# HPA054565, RRID:AB_2682525 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732404
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): IGSF1
Proper citation: Sigma-Aldrich Cat# HPA012732, RRID:AB_2732404 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2241243
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TTC25
Proper citation: Sigma-Aldrich Cat# HPA023908, RRID:AB_2241243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852395
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1267 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007208, RRID:AB_1852395 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684180
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GRHL3
Proper citation: Atlas Antibodies Cat# HPA059960, RRID:AB_2684180 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859392
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC1277 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): ZNF652
Proper citation: Sigma-Aldrich Cat# AV31678, RRID:AB_1859392 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857409
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): UAP1
Proper citation: Atlas Antibodies Cat# HPA014659, RRID:AB_1857409 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_330232
Comments: Applications: W. Consolidation on 11/2018: AB_10078266, AB_10104698, AB_2262427, AB_2314224, AB_330232. Info: Used By NYUIHC-1083.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Phospho-Ezrin (Thr567)/Radixin (Thr564)/Moesin (Thr558)
Proper citation: Cell Signaling Technology Cat# 3141, RRID:AB_330232 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857160
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human SLC41A1
Proper citation: Sigma-Aldrich Cat# HPA015138, RRID:AB_1857160 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
