Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-AC130352.1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA027116, RRID:AB_10603573 AC130352.1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10603573 Sigma-Aldrich HPA027116 2025-08-19 09:27:23 0
Anti-KCNA10 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA015061, RRID:AB_1855573 KCNA10 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_1855573 Sigma-Aldrich HPA015061 2025-08-19 09:27:20 0
Anti-KLRAQ1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA036791, RRID:AB_10671713 KLRAQ1 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10671713 Sigma-Aldrich HPA036791 2025-08-19 09:27:28 0
Anti-C14orf80 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA039050, RRID:AB_10670918 C14orf80 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10670918 Sigma-Aldrich HPA039050 2025-08-19 09:27:26 0
Anti-NDUFA2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA035933, RRID:AB_10669661 NDUFA2 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10669661 Sigma-Aldrich HPA035933 2025-08-19 09:27:26 0
Anti-PREX1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA001927, RRID:AB_1079674 Human PREX1 human Vendor recommendations: unknown rabbit AB_1079674 Sigma-Aldrich HPA001927 2025-08-19 09:27:35 0
Anti-RPTN
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030483, RRID:AB_2673495 RPTN human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2673495 Atlas Antibodies HPA030483 2025-08-19 09:27:39 0
Rabbit anti-NELFE Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A301-913A, RRID:AB_1524076 NELFE human Applications: WB, IP
Original Manufacturer
polyclonal rabbit AB_1524076 Bethyl A301-913A (also A301-913A-M, A301-913A-T) 2025-08-19 09:27:40 1
Anti-PSMD1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036737, RRID:AB_2675279 PSMD1 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2675279 Atlas Antibodies HPA036737 2025-08-19 07:34:40 0
Anti-GLB1L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043058, RRID:AB_10806375 GLB1L human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10806375 Atlas Antibodies HPA043058 2025-08-19 07:34:40 0
Anti-MYRFL
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049340, RRID:AB_2680719 MYRFL human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680719 Atlas Antibodies HPA049340 2025-08-19 07:34:40 0
Anti-THRA polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA009654, RRID:AB_1854603 THRA human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854603 Atlas Antibodies HPA009654 2025-08-19 07:34:51 0
Anti-LRRC53 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054062, RRID:AB_2682364 LRRC53 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682364 Atlas Antibodies HPA054062 2025-08-19 07:34:40 0
Anti-PEX7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049202, RRID:AB_2680674 PEX7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680674 Atlas Antibodies HPA049202 2025-08-19 07:34:40 0
Anti-OR52I2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049343, RRID:AB_2680721 OR52I2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680721 Atlas Antibodies HPA049343 2025-08-19 07:34:52 0
Anti-ARL10
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047044, RRID:AB_2679915 ARL10 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2679915 Atlas Antibodies HPA047044 2025-08-19 07:34:52 0
Anti-B4GALT6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058284, RRID:AB_2683668 B4GALT6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683668 Atlas Antibodies HPA058284 2025-08-19 07:34:40 0
Anti-CASC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039662, RRID:AB_10795468 CASC1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795468 Atlas Antibodies HPA039662 2025-08-19 07:34:52 0
Anti-MAB21L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049324, RRID:AB_2680712 MAB21L2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680712 Atlas Antibodies HPA049324 2025-08-19 07:34:52 0
Anti-AC017081.1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042797, RRID:AB_2678172 AC017081.1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVMTLNEHAAFKHLFNKAHLAPPLIHLTLS; Manufacturer approved use: IHC polyclonal rabbit AB_2678172 Atlas Antibodies HPA042797 2025-08-19 07:34:52 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.