Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796227
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): RNH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040781, RRID:AB_10796227 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1604287
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SAM68
Proper citation: Bethyl Cat# A302-110A, RRID:AB_1604287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682756
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPN
Proper citation: Atlas Antibodies Cat# HPA055244, RRID:AB_2682756 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959613
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): WDR43 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044733, RRID:AB_10959613 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964127
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): HS2ST1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043069, RRID:AB_10964127 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845577
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): NPRL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011741, RRID:AB_1845577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601928
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZMYND10
Proper citation: Atlas Antibodies Cat# HPA035255, RRID:AB_10601928 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602180
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LMOD1
Proper citation: Atlas Antibodies Cat# HPA028435, RRID:AB_10602180 Copy
Possibly Non-Specific
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603025
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SLC10A4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028835, RRID:AB_10603025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2105429
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot; Immunofluorescence
Host Organism: rabbit
Clonality polyclonal
Target(s): FOXD4L4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012836, RRID:AB_2105429 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852201
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human KRT14
Proper citation: Sigma-Aldrich Cat# HPA023040, RRID:AB_1852201 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851789
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human INHA
Proper citation: Sigma-Aldrich Cat# HPA019141, RRID:AB_1851789 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616027
Comments: Applications: W, IF-IC
ENCODE PROJECT External validation DATA SET is released testing lot 1 for any cell type or tissues; status is awaiting lab characterization
Consolidation on 9/2016: AB_2295073
Host Organism: rabbit
Clonality polyclonal
Target(s): H3
Proper citation: Cell Signaling Technology Cat# 9763, RRID:AB_2616027 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962482
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): HSPA1L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043285, RRID:AB_10962482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079995
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human SLC12A8
Proper citation: Sigma-Aldrich Cat# HPA001656, RRID:AB_1079995 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10881437
Comments: Used By NYUIHC-997
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): KLH conjugated synthetic peptide derived from human IL-6 N-terminus
Proper citation: Bioss Cat# bs-0781R, RRID:AB_10881437 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600208
Comments: Vendor recommendations: Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): CGN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027586, RRID:AB_10600208 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599823
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): QRSL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029585, RRID:AB_10599823 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857283
Comments: Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SMCR8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021557, RRID:AB_1857283 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673107
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ACOT11 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035309, RRID:AB_10673107 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
