Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686389
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KLHL12
Proper citation: Atlas Antibodies Cat# HPA071324, RRID:AB_2686389 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683091
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MMS19
Proper citation: Atlas Antibodies Cat# HPA056299, RRID:AB_2683091 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683851
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PALM2-AKAP2
Proper citation: Atlas Antibodies Cat# HPA058905, RRID:AB_2683851 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601030
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF189
Proper citation: Atlas Antibodies Cat# HPA034814, RRID:AB_10601030 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683409
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): ATP6V1D
Proper citation: Sigma-Aldrich Cat# HPA057316, RRID:AB_2683409 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680953
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SPATA45
Proper citation: Atlas Antibodies Cat# HPA049921, RRID:AB_2680953 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685237
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PRRC2B
Proper citation: Atlas Antibodies Cat# HPA064301, RRID:AB_2685237 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681701
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): WNT6
Proper citation: Atlas Antibodies Cat# HPA052031, RRID:AB_2681701 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615878
Comments: manufacturer recommendations: IgG WB(1:100-500), ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); Western Blot; ELISA; Flow Cytometry; Immunohistochemistry; Immunoprecipitation; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10855094, AB_2615878.
Host Organism: rabbit
Clonality polyclonal
Target(s): Rabbit HDAC11
Proper citation: Bioss Cat# bs-2894R, RRID:AB_2615878 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_640607
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): FOXO1
Proper citation: Santa Cruz Biotechnology Cat# sc-11350, RRID:AB_640607 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2037593
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39742 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): PABPN1
Proper citation: GeneTex Cat# GTX101490, RRID:AB_2037593 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964133
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): NINJ1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045063, RRID:AB_10964133 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078595
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): CXorf36 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA002806, RRID:AB_1078595 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2213805
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): URB2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA008902, RRID:AB_2213805 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671506
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): GTPBP8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA034831, RRID:AB_10671506 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670380
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): BOD1L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037362, RRID:AB_10670380 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10598915
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SASH1
Proper citation: Atlas Antibodies Cat# HPA029947, RRID:AB_10598915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859189
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF318
Proper citation: Atlas Antibodies Cat# HPA027022, RRID:AB_1859189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602151
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RABIF
Proper citation: Atlas Antibodies Cat# HPA027715, RRID:AB_10602151 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10793973
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CLC
Proper citation: Atlas Antibodies Cat# HPA041751, RRID:AB_10793973 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.