Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080644
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPT; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFP36L1
Proper citation: Atlas Antibodies Cat# HPA001301, RRID:AB_1080644 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10804910
Comments: Applications: Western Blot, Dot Blot
Host Organism: Rabbit
Clonality polyclonal
Target(s): Histone H3
Proper citation: Novus Cat# NB21-1254, RRID:AB_10804910 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_564153
Comments: Used By NYUIHC-571
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism:
Clonality monoclonal
Target(s): Prokaryotic recombinant fusion protein corresponding to th ec-terminus of the TRP-1 molecule
Proper citation: Leica Biosystems Cat# NCL-TRP-1, RRID:AB_564153 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1576598
Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): Tat-SF1
Proper citation: Thermo Fisher Scientific Cat# A302-023A, RRID:AB_1576598 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681866
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): CYB561A3
Proper citation: Sigma-Aldrich Cat# HPA052548, RRID:AB_2681866 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079729
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): RAB25
Proper citation: Atlas Antibodies Cat# HPA010872, RRID:AB_1079729 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967599
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): SHF antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046113, RRID:AB_10967599 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602003
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PSMA5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028441, RRID:AB_10602003 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857869
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TDRD7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024529, RRID:AB_1857869 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2340832
Comments: Originating manufacturer of this product
Host Organism:
Clonality unknown
Target(s): Mouse IgG (H+L)
Proper citation: Jackson ImmunoResearch Labs Cat# 715-295-151, RRID:AB_2340832 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844656
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): AHNAK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019070, RRID:AB_1844656 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669903
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): CACNB2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035326, RRID:AB_10669903 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845596
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): C17orf57 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026561, RRID:AB_1845596 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601242
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PARVG antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031834, RRID:AB_10601242 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_306445
Comments: validation status unknown, seller recommendations provided in 2012: ELISA, Flow Cyt, ICC/IF, IHC-FoFr, IHC-P, sELISA, WB; Immunofluorescence; Flow Cytometry; Chromatography; ELISA; Immunohistochemistry - frozen; Other; Western Blot; Immunohistochemistry; Immunocytochemistry; Immunohistochemistry - fixed
Host Organism: mouse
Clonality monoclonal
Target(s): Cardiac Troponin T antibody [1C11]
Proper citation: Abcam Cat# ab8295, RRID:AB_306445 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_937962
Comments: Applications: IP
Host Organism: rabbit
Clonality polyclonal
Target(s): PTRF
Proper citation: Bethyl Cat# A301-270A, RRID:AB_937962 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856577
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SAR1A
Proper citation: Atlas Antibodies Cat# HPA006923, RRID:AB_1856577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685559
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): UGT8
Proper citation: Atlas Antibodies Cat# HPA065785, RRID:AB_2685559 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846554
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CES1
Proper citation: Atlas Antibodies Cat# HPA012023, RRID:AB_1846554 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685685
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PAG1
Proper citation: Atlas Antibodies Cat# HPA066527, RRID:AB_2685685 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.