Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671235
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): CSNK1G2
Proper citation: Atlas Antibodies Cat# HPA034868, RRID:AB_10671235 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601882
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): THEMIS2
Proper citation: Atlas Antibodies Cat# HPA031097, RRID:AB_10601882 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684594
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PCBD1
Proper citation: Atlas Antibodies Cat# HPA061723, RRID:AB_2684594 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674017
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TAF8
Proper citation: Atlas Antibodies Cat# HPA031731, RRID:AB_2674017 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2256120
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TMEM176A
Proper citation: Atlas Antibodies Cat# HPA008770, RRID:AB_2256120 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680933
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF852
Proper citation: Atlas Antibodies Cat# HPA049885, RRID:AB_2680933 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672623
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ACOX2
Proper citation: Atlas Antibodies Cat# HPA038280, RRID:AB_10672623 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080644
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPT; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFP36L1
Proper citation: Atlas Antibodies Cat# HPA001301, RRID:AB_1080644 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10804910
Comments: Applications: Western Blot, Dot Blot
Host Organism: Rabbit
Clonality polyclonal
Target(s): Histone H3
Proper citation: Novus Cat# NB21-1254, RRID:AB_10804910 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964911
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TBL3
Proper citation: Atlas Antibodies Cat# HPA042562, RRID:AB_10964911 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078192
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human ARG2
Proper citation: Sigma-Aldrich Cat# HPA000663, RRID:AB_1078192 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1659789
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality polyclonal
Target(s): BCCIP
Proper citation: Bethyl Cat# A302-196A, RRID:AB_1659789 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11150299
Comments: Discontinued: 2016; Used By NYUIHC-598
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality unknown
Target(s): Rasied against a peptide mapping near the c-terminus of TRP-2 of human origin.
Proper citation: Santa Cruz Biotechnology Cat# sc-10452, RRID:AB_11150299 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2222168
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: western blot, ELISA, immunocytochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: goat
Clonality polyclonal
Target(s): Adamts18
Proper citation: Santa Cruz Biotechnology Cat# sc-67707, RRID:AB_2222168 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11179079
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality monoclonal
Target(s): IGF2BP1
Proper citation: Cell Signaling Technology Cat# 8482, RRID:AB_11179079 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_355342
Comments: Applications: Western Blot, Neutralization, Immunocytochemistry
Host Organism: Goat
Clonality polyclonal
Target(s): CXCL9/MIG
Proper citation: R and D Systems Cat# AF392, RRID:AB_355342 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601132
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MAP4K3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030380, RRID:AB_10601132 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669658
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): C4orf14 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035839, RRID:AB_10669658 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601968
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): AHCTF1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031658, RRID:AB_10601968 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10608043
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 09282-4G6 for not specified; status is not pursued
Host Organism: mouse
Clonality monoclonal
Target(s): ZNF622
Proper citation: Sigma-Aldrich Cat# SAB1401933, RRID:AB_10608043 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.