Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2133570
Comments: Application(s): FFPE,Immunofluorescence,Immunohistochemistry,Immunoprecipitation,Western Blot; Date Deposited: 12/22/2004
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rat
Clonality monoclonal
Target(s): Keratin, type I; cytokeratin 19
Proper citation: DSHB Cat# TROMA-III, RRID:AB_2133570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796226
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): NEK8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040679, RRID:AB_10796226 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849181
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUS
Proper citation: Atlas Antibodies Cat# HPA008784, RRID:AB_1849181 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681809
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): IL33
Proper citation: Atlas Antibodies Cat# HPA052386, RRID:AB_2681809 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858672
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): USP25
Proper citation: Atlas Antibodies Cat# HPA018297, RRID:AB_1858672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961260
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KBTBD7
Proper citation: Atlas Antibodies Cat# HPA043709, RRID:AB_10961260 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672614
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): C10orf85 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA037933, RRID:AB_10672614 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078423
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human CCDC80
Proper citation: Sigma-Aldrich Cat# HPA002266, RRID:AB_1078423 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854981
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PARP14
Proper citation: Sigma-Aldrich Cat# HPA012063, RRID:AB_1854981 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855165
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PDZD11
Proper citation: Sigma-Aldrich Cat# HPA003972, RRID:AB_1855165 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2255626
Comments: Application(s): FACS,Immunofluorescence,Immunohistochemistry,Immunoprecipitation; Date Deposited: 01/23/2006
Host Organism: rat
Clonality monoclonal
Target(s): insulin (proinsulin; C-peptide)
Proper citation: DSHB Cat# GN-ID4, RRID:AB_2255626 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335662
Comments: Used By NYUIHC-373
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): ND
Proper citation: Cell Signaling Technology Cat# 2492, RRID:AB_2335662 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682655
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DEPDC5
Proper citation: Atlas Antibodies Cat# HPA054969, RRID:AB_2682655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794998
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1328
Proper citation: Atlas Antibodies Cat# HPA040946, RRID:AB_10794998 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684265
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SATL1
Proper citation: Atlas Antibodies Cat# HPA060369, RRID:AB_2684265 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677830
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): OCEL1
Proper citation: Atlas Antibodies Cat# HPA042070, RRID:AB_2677830 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794645
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SNRK
Proper citation: Atlas Antibodies Cat# HPA042163, RRID:AB_10794645 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681032
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): VSIG2
Proper citation: Atlas Antibodies Cat# HPA050147, RRID:AB_2681032 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683273
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TNNT3
Proper citation: Atlas Antibodies Cat# HPA056909, RRID:AB_2683273 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682674
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF607
Proper citation: Atlas Antibodies Cat# HPA055018, RRID:AB_2682674 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
