Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11179079
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality monoclonal
Target(s): IGF2BP1
Proper citation: Cell Signaling Technology Cat# 8482, RRID:AB_11179079 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854171
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MTCH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015971, RRID:AB_1854171 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2142366
Comments: Applications: IHC(P) & WB. The following antibodies were determined to be duplicates and consolidated by curator on 10/2018: AB_2142366, AB_10141019, AB_11214025.
Host Organism: rabbit
Clonality polyclonal
Target(s): Ki-67
Proper citation: Millipore Cat# AB9260, RRID:AB_2142366 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965169
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): C12orf43 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046148, RRID:AB_10965169 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602088
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SBK2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030631, RRID:AB_10602088 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794522
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PGF antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041624, RRID:AB_10794522 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846282
Comments: Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MUC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004179, RRID:AB_1846282 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671579
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): UPK1B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031799, RRID:AB_10671579 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669782
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TGFBRAP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038397, RRID:AB_10669782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697714
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): RNASEH2B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040084, RRID:AB_10697714 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795504
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): IL13 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042421, RRID:AB_10795504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079140
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human INE1
Proper citation: Sigma-Aldrich Cat# HPA003212, RRID:AB_1079140 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080602
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human WWTR1
Proper citation: Sigma-Aldrich Cat# HPA007415, RRID:AB_1080602 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848399
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM40B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019657, RRID:AB_1848399 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848879
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC155 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019940, RRID:AB_1848879 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794306
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): TTC31 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041783, RRID:AB_10794306 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2124997
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Immunofluorescence; Immunocytochemistry; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): IL-17 (H-132)
Proper citation: Santa Cruz Biotechnology Cat# sc-7927, RRID:AB_2124997 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2117316
Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E0912 for K562,HepG2; status is awaiting lab characterization
Host Organism: goat
Clonality polyclonal
Target(s): HNRNPC
Proper citation: Santa Cruz Biotechnology Cat# sc-10037, RRID:AB_2117316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2671360
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGRSVLGGVSWFQCTESLGPLTLQHGNLGVDLLLFPSRQKLSFALSGPALGKGVGVNEQLF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): AC006449.2
Proper citation: Atlas Antibodies Cat# HPA023912, RRID:AB_2671360 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1234567
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IL17RB
Proper citation: Atlas Antibodies Cat# HPA005482, RRID:AB_1234567 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
