Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854831
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TNFRSF11B
Proper citation: Atlas Antibodies Cat# HPA027013, RRID:AB_1854831 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10891055
Comments: Applications: WB, IP, IF-IC
Consolidation on 11/2018: AB_10891055, AB_10892612.
Host Organism: rabbit
Clonality monoclonal
Target(s): FoxA2/HNF3
Proper citation: Cell Signaling Technology Cat# 8186, RRID:AB_10891055 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_354651
Comments: Applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry
Host Organism: Goat
Clonality polyclonal
Target(s): DPPIV/CD26
Proper citation: R and D Systems Cat# AF1180, RRID:AB_354651 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732154
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): YAP1
Proper citation: Atlas Antibodies Cat# HPA070359, RRID:AB_2732154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11172792
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40807 for HepG2,K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRNPR
Proper citation: GeneTex Cat# GTX106526, RRID:AB_11172792 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1159482
Comments: Used By NYUIHC-1080
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): ND
Proper citation: Cell Marque Cat# 307M-95, RRID:AB_1159482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1840959
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 11056-3B5 for GM12878,K562; status is eligible for new data (via exemption)
Host Organism: mouse
Clonality monoclonal
Target(s): CREM
Proper citation: Sigma-Aldrich Cat# WH0001390M2, RRID:AB_1840959 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2058911
Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot KC112 for not specified; status is not pursued
Host Organism: goat
Clonality polyclonal
Target(s): ATF6
Proper citation: Santa Cruz Biotechnology Cat# sc-14253, RRID:AB_2058911 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679870
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DAPL1
Proper citation: Atlas Antibodies Cat# HPA046937, RRID:AB_2679870 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685352
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DAAM1
Proper citation: Atlas Antibodies Cat# HPA064789, RRID:AB_2685352 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672205
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): EDEM3
Proper citation: Atlas Antibodies Cat# HPA027297, RRID:AB_2672205 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681286
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FBXO24
Proper citation: Atlas Antibodies Cat# HPA050951, RRID:AB_2681286 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680853
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NOL7
Proper citation: Atlas Antibodies Cat# HPA049693, RRID:AB_2680853 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666109
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LHX2
Proper citation: Atlas Antibodies Cat# HPA000838, RRID:AB_2666109 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675489
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RANBP3L
Proper citation: Atlas Antibodies Cat# HPA037472, RRID:AB_2675489 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686474
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM13B
Proper citation: Atlas Antibodies Cat# HPA071936, RRID:AB_2686474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678915
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GAS2L2
Proper citation: Atlas Antibodies Cat# HPA044370, RRID:AB_2678915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794046
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACAA2
Proper citation: Atlas Antibodies Cat# HPA042303, RRID:AB_10794046 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847368
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CYB5D1
Proper citation: Atlas Antibodies Cat# HPA021632, RRID:AB_1847368 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686886
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): TMED1
Proper citation: Atlas Antibodies Cat# HPA078574, RRID:AB_2686886 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
