Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599283
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FRMD1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030346, RRID:AB_10599283 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795704
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): SBNO1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042388, RRID:AB_10795704 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078550
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human COL6A3
Proper citation: Sigma-Aldrich Cat# HPA010080, RRID:AB_1078550 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2336025
Comments: Used By NYUIHC-477
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Recombinant full length protein
Proper citation: Zeta Corporation Cat# Z2011, RRID:AB_2336025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2336009
Comments: Used By NYUIHC-1398
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality monoclonal
Target(s): MUM1 protein is expressed in a wide spectrum of hematolymphoid neoplasms and in malignant melanoma.
Proper citation: Ventana Medical Systems Cat# 760-4529, RRID:AB_2336009 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078531
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CLCN5
Proper citation: Atlas Antibodies Cat# HPA000401, RRID:AB_1078531 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10752094
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HTATSF1
Proper citation: Atlas Antibodies Cat# HPA000504, RRID:AB_10752094 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615998
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20130125.RAP for not specified; status is not pursued
Host Organism: mouse
Clonality unknown
Target(s): HES1
Proper citation: CDI Cat# R159.1.4A11, RRID:AB_2615998 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669461
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): FAM151A
Proper citation: Atlas Antibodies Cat# HPA016840, RRID:AB_2669461 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683522
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CD1E
Proper citation: Atlas Antibodies Cat# HPA057769, RRID:AB_2683522 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686279
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): INCENP
Proper citation: Atlas Antibodies Cat# HPA070550, RRID:AB_2686279 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683192
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CACNG6
Proper citation: Atlas Antibodies Cat# HPA056615, RRID:AB_2683192 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683287
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SIX2
Proper citation: Atlas Antibodies Cat# HPA056958, RRID:AB_2683287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602602
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRK; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): GUCA1B
Proper citation: Atlas Antibodies Cat# HPA031453, RRID:AB_10602602 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675108
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): LRPPRC
Proper citation: Sigma-Aldrich Cat# HPA036409, RRID:AB_2675108 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673159
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): KCNE2
Proper citation: Atlas Antibodies Cat# HPA029706, RRID:AB_2673159 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795295
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM186B
Proper citation: Atlas Antibodies Cat# HPA039736, RRID:AB_10795295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686275
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TCF7
Proper citation: Atlas Antibodies Cat# HPA070505, RRID:AB_2686275 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685228
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DZANK1
Proper citation: Atlas Antibodies Cat# HPA064255, RRID:AB_2685228 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676792
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PUSL1
Proper citation: Atlas Antibodies Cat# HPA039999, RRID:AB_2676792 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.