Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600981
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): APEX2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030872, RRID:AB_10600981 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2036940
Comments: Applications: WB, ICC/IF, IHC-P, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): HMBOX1
Proper citation: GeneTex Cat# GTX104189, RRID:AB_2036940 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10696935
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM120B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037519, RRID:AB_10696935 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960352
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TUBGCP6
Proper citation: Atlas Antibodies Cat# HPA043928, RRID:AB_10960352 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965852
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC66
Proper citation: Atlas Antibodies Cat# HPA044185, RRID:AB_10965852 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673441
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): EPB42 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040261, RRID:AB_10673441 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079842
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human RPL30
Proper citation: Sigma-Aldrich Cat# HPA002651, RRID:AB_1079842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684587
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPRD2
Proper citation: Atlas Antibodies Cat# HPA061693, RRID:AB_2684587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603125
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PAK1IP1
Proper citation: Atlas Antibodies Cat# HPA030112, RRID:AB_10603125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1977252
Comments: ENCODE PROJECT External validation for lot# Unknown is available under ENCODE ID: ENCAB000ANU
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): H3K4me3
Proper citation: Millipore Cat# 07-473, RRID:AB_1977252 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796118
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GADL1
Proper citation: Atlas Antibodies Cat# HPA040229, RRID:AB_10796118 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670553
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PHACTR2
Proper citation: Atlas Antibodies Cat# HPA031720, RRID:AB_10670553 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676247
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP46
Proper citation: Atlas Antibodies Cat# HPA038868, RRID:AB_2676247 Copy
Discontinued Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_937896
Comments: ENCODE PROJECT External validation DATA SET is released testing lot A301-341A-1 for SKNSH,K562,HepG2,GM12878; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): HDAC6
Proper citation: Bethyl Cat# A301-341A, RRID:AB_937896 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603451
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQ; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): C1orf158
Proper citation: Atlas Antibodies Cat# HPA028396, RRID:AB_10603451 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2753162
Comments: Discontinued; Applications: IHC-P, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): HOXA3
Proper citation: GeneTex Cat# GTX11945, RRID:AB_2753162 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795029
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): AC005609.17 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA038276, RRID:AB_10795029 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080225
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TBX22
Proper citation: Atlas Antibodies Cat# HPA003105, RRID:AB_1080225 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732730
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NTNG2
Proper citation: Atlas Antibodies Cat# HPA065089, RRID:AB_2732730 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844380
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): IQUB
Proper citation: Atlas Antibodies Cat# HPA020621, RRID:AB_1844380 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
