Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-HERPUD1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA040754, RRID:AB_10794068 | HERPUD1 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10794068 | Atlas Antibodies | HPA040754 | 2025-08-19 08:23:18 | 0 | ||
|
Anti-THBS3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006293, RRID:AB_10602898 | THBS3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TVGESRQMVAVAEKIRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTG; Manufacturer approved use: IHC | polyclonal | rabbit | AB_10602898 | Atlas Antibodies | HPA006293 | 2025-08-19 08:23:17 | 0 | ||
|
Anti-FUCA2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA031659, RRID:AB_10600661 | FUCA2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10600661 | Atlas Antibodies | HPA031659 | 2025-08-19 08:23:18 | 0 | ||
|
Anti-ACOX1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA028759, RRID:AB_10601352 | ACOX1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601352 | Atlas Antibodies | HPA028759 | 2025-08-19 08:23:17 | 0 | ||
|
Anti-IDUA polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA054254, RRID:AB_2682429 | IDUA | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682429 | Atlas Antibodies | HPA054254 | 2025-08-19 08:23:18 | 0 | ||
|
Anti-PALMD Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA017959, RRID:AB_1854949 | PALMD | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1854949 | Atlas Antibodies | HPA017959 | 2025-08-19 08:23:17 | 0 | ||
|
Anti-ZNF322 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046692, RRID:AB_2679755 | ZNF322 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679755 | Atlas Antibodies | HPA046692 | 2025-08-19 08:23:18 | 0 | ||
|
GMEB2 Antibody Resource Report Resource Website Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A303-677A, RRID:AB_11204923 | GMEB2 | human | Discontinued; Applications: IP (2-10 µg/mg lysate) | polyclonal | rabbit | AB_11204923 | Thermo Fisher Scientific | A303-677A (also A303-677A-T) | 2025-08-19 08:23:20 | 0 | ||
|
Anti-STAG3 Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA049106, RRID:AB_2680634 | STAG3 | human | unknown | rabbit | AB_2680634 | Sigma-Aldrich | HPA049106 | 2025-08-19 08:23:19 | 0 | |||
|
Anti-C6orf225 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA036068, RRID:AB_10673495 | C6orf225 antibody produced in rabbit | human | polyclonal | rabbit | AB_10673495 | Atlas Antibodies | HPA036068 | 2025-08-19 08:23:21 | 0 | |||
|
Anti-OTUD6A Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA053304, RRID:AB_2682107 | OTUD6A | human | unknown | rabbit | AB_2682107 | Sigma-Aldrich | HPA053304 | 2025-08-19 08:23:20 | 0 | |||
|
Rabbit Anti-Human IGHA2, Unconjugated Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006013, RRID:AB_1079119 | IGHA2 | human | unknown | rabbit | AB_1079119 | Atlas Antibodies | HPA006013 | 2025-08-19 08:23:26 | 0 | |||
|
Anti-ZFY antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA001748, RRID:AB_1080650 | ZFY antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1080650 | Sigma-Aldrich | HPA001748 | 2025-08-19 08:23:34 | 0 | ||
|
Monoclonal Anti-IRF2 antibody produced in mouse Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# WH0003660M2, RRID:AB_1842143 | IRF2 antibody produced in mouse | human | Vendor recommendations: IgG2akappa indirect immunofluorescence: suitable, indirect ELISA: suitable, immunoblotting: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunofluorescence; ELISA; Immunohistochemistry; Western Blot | monoclonal | mouse | AB_1842143 | Sigma-Aldrich | WH0003660M2 | 2025-08-19 08:24:04 | 0 | ||
|
Anti-CIDEC antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020553, RRID:AB_1846769 | CIDEC antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1846769 | Sigma-Aldrich | HPA020553 | 2025-08-19 08:25:08 | 0 | ||
|
Anti-DES antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA018803, RRID:AB_1847616 | DES antibody produced in rabbit | human | Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1847616 | Sigma-Aldrich | HPA018803 | 2025-08-19 08:25:10 | 2 | ||
|
Anti-COX10 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA032005, RRID:AB_10603560 | COX10 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10603560 | Sigma-Aldrich | HPA032005 | 2025-08-19 08:25:18 | 1 | ||
|
Anti-ODF2 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA001874, RRID:AB_1079522 | Human ODF2 | human | Vendor recommendations: | unknown | rabbit | AB_1079522 | Sigma-Aldrich | HPA001874 | 2025-08-19 08:25:19 | 2 | ||
|
Anti-KIF24 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020643, RRID:AB_2131749 | KIF24 antibody produced in rabbit | human | Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_2131749 | Sigma-Aldrich | HPA020643 | 2025-08-19 08:25:30 | 0 | ||
|
Anti-PEG10 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA021324, RRID:AB_1855181 | Human PEG10 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855181 | Sigma-Aldrich | HPA021324 | 2025-08-19 08:25:31 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.