Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680900
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ST3GAL4
Proper citation: Atlas Antibodies Cat# HPA049827, RRID:AB_2680900 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683025
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PSMD7
Proper citation: Sigma-Aldrich Cat# HPA056069, RRID:AB_2683025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_301278
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality polyclonal
Target(s): XRCC4
Proper citation: Abcam Cat# ab145, RRID:AB_301278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684660
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): PRL
Proper citation: Sigma-Aldrich Cat# HPA062017, RRID:AB_2684660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686817
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): PI4K2A
Proper citation: Atlas Antibodies Cat# HPA076857, RRID:AB_2686817 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682020
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C17orf105
Proper citation: Atlas Antibodies Cat# HPA053028, RRID:AB_2682020 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859011
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFAND3
Proper citation: Atlas Antibodies Cat# HPA016755, RRID:AB_1859011 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796454
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): SPG21
Proper citation: Atlas Antibodies Cat# HPA040436, RRID:AB_10796454 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849192
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUT11
Proper citation: Atlas Antibodies Cat# HPA014033, RRID:AB_1849192 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2797259
Comments: Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Host Organism: rabbit
Clonality unknown
Target(s): RUFY1
Proper citation: Atlas Antibodies Cat# HPA057614, RRID:AB_2797259 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674274
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COPS7B
Proper citation: Atlas Antibodies Cat# HPA034676, RRID:AB_2674274 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667472
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ATF6
Proper citation: Atlas Antibodies Cat# HPA005935, RRID:AB_2667472 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680555
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RNF222
Proper citation: Atlas Antibodies Cat# HPA048916, RRID:AB_2680555 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684157
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GFPT2
Proper citation: Atlas Antibodies Cat# HPA059910, RRID:AB_2684157 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732783
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): DIRC1
Proper citation: Atlas Antibodies Cat# HPA068508, RRID:AB_2732783 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684565
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NXF1
Proper citation: Atlas Antibodies Cat# HPA061593, RRID:AB_2684565 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078281
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GRK3
Proper citation: Atlas Antibodies Cat# HPA000804, RRID:AB_1078281 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079850
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPS6KA1
Proper citation: Atlas Antibodies Cat# HPA007981, RRID:AB_1079850 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10967610
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RBSN
Proper citation: Atlas Antibodies Cat# HPA044878, RRID:AB_10967610 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672903
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SH3BP4
Proper citation: Atlas Antibodies Cat# HPA037533, RRID:AB_10672903 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
