Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794068
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HERPUD1
Proper citation: Atlas Antibodies Cat# HPA040754, RRID:AB_10794068 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602898
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TVGESRQMVAVAEKIRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): THBS3
Proper citation: Atlas Antibodies Cat# HPA006293, RRID:AB_10602898 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600661
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUCA2
Proper citation: Atlas Antibodies Cat# HPA031659, RRID:AB_10600661 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601352
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ACOX1
Proper citation: Atlas Antibodies Cat# HPA028759, RRID:AB_10601352 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682429
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IDUA
Proper citation: Atlas Antibodies Cat# HPA054254, RRID:AB_2682429 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854949
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PALMD
Proper citation: Atlas Antibodies Cat# HPA017959, RRID:AB_1854949 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679755
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF322
Proper citation: Atlas Antibodies Cat# HPA046692, RRID:AB_2679755 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11204923
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality polyclonal
Target(s): GMEB2
Proper citation: Thermo Fisher Scientific Cat# A303-677A, RRID:AB_11204923 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680634
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): STAG3
Proper citation: Sigma-Aldrich Cat# HPA049106, RRID:AB_2680634 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673495
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf225 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA036068, RRID:AB_10673495 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682107
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): OTUD6A
Proper citation: Sigma-Aldrich Cat# HPA053304, RRID:AB_2682107 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079119
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): IGHA2
Proper citation: Atlas Antibodies Cat# HPA006013, RRID:AB_1079119 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080650
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ZFY antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA001748, RRID:AB_1080650 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1842143
Comments: Vendor recommendations: IgG2akappa indirect immunofluorescence: suitable, indirect ELISA: suitable, immunoblotting: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunofluorescence; ELISA; Immunohistochemistry; Western Blot
Host Organism: mouse
Clonality monoclonal
Target(s): IRF2 antibody produced in mouse
Proper citation: Sigma-Aldrich Cat# WH0003660M2, RRID:AB_1842143 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846769
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CIDEC antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020553, RRID:AB_1846769 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847616
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): DES antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018803, RRID:AB_1847616 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603560
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): COX10 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA032005, RRID:AB_10603560 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079522
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality unknown
Target(s): Human ODF2
Proper citation: Sigma-Aldrich Cat# HPA001874, RRID:AB_1079522 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2131749
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KIF24 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020643, RRID:AB_2131749 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855181
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PEG10
Proper citation: Sigma-Aldrich Cat# HPA021324, RRID:AB_1855181 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
