Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078077
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ABCA3
Proper citation: Atlas Antibodies Cat# HPA007884, RRID:AB_1078077 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600711
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HEXDC
Proper citation: Atlas Antibodies Cat# HPA027844, RRID:AB_10600711 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078294
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): BOLA1
Proper citation: Atlas Antibodies Cat# HPA007005, RRID:AB_1078294 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852144
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KCNMB3
Proper citation: Atlas Antibodies Cat# HPA019185, RRID:AB_1852144 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669392
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): TMEM222
Proper citation: Atlas Antibodies Cat# HPA016579, RRID:AB_2669392 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847310
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CTBP2
Proper citation: Atlas Antibodies Cat# HPA023564, RRID:AB_1847310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963071
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): GPR83 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044493, RRID:AB_10963071 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961769
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): C20orf166 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045553, RRID:AB_10961769 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856137
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): RBM7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA013993, RRID:AB_1856137 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858442
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human TTK
Proper citation: Sigma-Aldrich Cat# HPA016834, RRID:AB_1858442 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686885
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): NUDT9
Proper citation: Atlas Antibodies Cat# HPA078535, RRID:AB_2686885 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680395
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA0922
Proper citation: Atlas Antibodies Cat# HPA048443, RRID:AB_2680395 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079905
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SEMA5A
Proper citation: Atlas Antibodies Cat# HPA004632, RRID:AB_1079905 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673625
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): DDX21
Proper citation: Atlas Antibodies Cat# HPA036592, RRID:AB_10673625 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686874
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): APC2
Proper citation: Atlas Antibodies Cat# HPA078002, RRID:AB_2686874 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616118
Comments: ENCODE PROJECT External validation DATA SET is released testing lot Lot 1 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): Ubx
Proper citation: Kevin White Cat# UBX1 - cDNA UBX18.704 from ProteinGentech, RRID:AB_2616118 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683291
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DLX2
Proper citation: Atlas Antibodies Cat# HPA056965, RRID:AB_2683291 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682425
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPS6KA2
Proper citation: Atlas Antibodies Cat# HPA054237, RRID:AB_2682425 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079535
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): OTC
Proper citation: Atlas Antibodies Cat# HPA000243, RRID:AB_1079535 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673583
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF771
Proper citation: Atlas Antibodies Cat# HPA030730, RRID:AB_2673583 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.