Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,391 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CLCN5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003213, RRID:AB_2666843 CLCN5 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2666843 Atlas Antibodies HPA003213 2025-08-19 09:09:24 0
Anti-NXPE1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049133, RRID:AB_2680647 NXPE1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680647 Atlas Antibodies HPA049133 2025-08-19 09:09:26 0
Anti-DZANK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059478, RRID:AB_2684033 DZANK1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684033 Atlas Antibodies HPA059478 2025-08-19 09:09:40 0
Anti-LIN37 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043253, RRID:AB_2678391 LIN37 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678391 Atlas Antibodies HPA043253 2025-08-19 09:09:25 0
Anti-RPUSD3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037551, RRID:AB_2675538 RPUSD3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675538 Atlas Antibodies HPA037551 2025-08-19 09:09:39 0
Anti-MAK16 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044417, RRID:AB_2678935 MAK16 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678935 Atlas Antibodies HPA044417 2025-08-19 09:09:25 0
Anti-PPARG polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051239, RRID:AB_2681400 PPARG human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681400 Atlas Antibodies HPA051239 2025-08-19 09:09:39 0
Anti-PPP1R3G polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056393, RRID:AB_2683115 PPP1R3G human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683115 Atlas Antibodies HPA056393 2025-08-19 09:09:40 0
Anti-DUT polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060360, RRID:AB_2684262 DUT human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684262 Atlas Antibodies HPA060360 2025-08-19 09:09:40 0
Anti-ITGA2
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA063556, RRID:AB_2685040 ITGA2 human unknown rabbit AB_2685040 Sigma-Aldrich HPA063556 2025-08-19 09:09:41 0
Anti-MFSD2A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043107, RRID:AB_10794387 MFSD2A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794387 Atlas Antibodies HPA043107 2025-08-19 09:09:25 0
Anti-PARN antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA012010, RRID:AB_1854976 PARN antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot polyclonal rabbit AB_1854976 Sigma-Aldrich HPA012010 2025-08-19 09:15:38 0
Anti-TRAPPC9 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA025246, RRID:AB_1854458 TRAPPC9 human polyclonal rabbit AB_1854458 Atlas Antibodies HPA025246 2025-08-19 09:15:35 0
Anti-RAB11FIP1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA024010, RRID:AB_1855991 Human RAB11FIP1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1855991 Sigma-Aldrich HPA024010 2025-08-19 09:15:32 1
Su(var)3-9-dmelanogaster
 
Resource Report
Resource Website
Rating or validation data
Abcam Cat# ab4811, RRID:AB_449347 Su(var)3-9 drosophila melanogaster ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization polyclonal rabbit AB_449347 Abcam ab4811 2025-08-19 09:15:54 0
Anti-CCR6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA014488, RRID:AB_1846639 CCR6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1846639 Atlas Antibodies HPA014488 2025-08-19 09:16:16 0
Anti-BRWD3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA012802, RRID:AB_2066662 BRWD3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE; Manufacturer approved use: ICC-IF, IHC polyclonal rabbit AB_2066662 Atlas Antibodies HPA012802 2025-08-19 09:16:12 0
NFYA-human
 
Resource Report
Resource Website
Rating or validation data
Roberto Mantovani Cat# NF-YA, RRID:AB_2616332 NFYA Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data unknown rabbit AB_2616332 Roberto Mantovani NF-YA (also ENCAB000AJC) 2025-08-19 09:12:18 0
GTF3C2-human
 
Resource Report
Resource Website
Rating or validation data
Robert White Cat# TFIIIC-110 4286, RRID:AB_2616326 GTF3C2 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data unknown rabbit AB_2616326 Robert White TFIIIC-110 4286 (also ENCAB000ALX) 2025-08-19 09:12:17 0
Anti-ERLEC1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031501, RRID:AB_10600104 ERLEC1 mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600104 Atlas Antibodies HPA031501 2025-08-19 09:12:21 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.