Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666843
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CLCN5
Proper citation: Atlas Antibodies Cat# HPA003213, RRID:AB_2666843 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680647
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NXPE1
Proper citation: Atlas Antibodies Cat# HPA049133, RRID:AB_2680647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684033
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DZANK1
Proper citation: Atlas Antibodies Cat# HPA059478, RRID:AB_2684033 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678391
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LIN37
Proper citation: Atlas Antibodies Cat# HPA043253, RRID:AB_2678391 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675538
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RPUSD3
Proper citation: Atlas Antibodies Cat# HPA037551, RRID:AB_2675538 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678935
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MAK16
Proper citation: Atlas Antibodies Cat# HPA044417, RRID:AB_2678935 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681400
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPARG
Proper citation: Atlas Antibodies Cat# HPA051239, RRID:AB_2681400 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683115
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PPP1R3G
Proper citation: Atlas Antibodies Cat# HPA056393, RRID:AB_2683115 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684262
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DUT
Proper citation: Atlas Antibodies Cat# HPA060360, RRID:AB_2684262 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685040
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): ITGA2
Proper citation: Sigma-Aldrich Cat# HPA063556, RRID:AB_2685040 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794387
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MFSD2A
Proper citation: Atlas Antibodies Cat# HPA043107, RRID:AB_10794387 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854976
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): PARN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA012010, RRID:AB_1854976 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854458
Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): TRAPPC9
Proper citation: Atlas Antibodies Cat# HPA025246, RRID:AB_1854458 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855991
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human RAB11FIP1
Proper citation: Sigma-Aldrich Cat# HPA024010, RRID:AB_1855991 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_449347
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): Su(var)3-9
Proper citation: Abcam Cat# ab4811, RRID:AB_449347 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846639
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCR6
Proper citation: Atlas Antibodies Cat# HPA014488, RRID:AB_1846639 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2066662
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDLRLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQMATERDLMAWSRRVVVNELNNGVSRVQEE; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): BRWD3
Proper citation: Atlas Antibodies Cat# HPA012802, RRID:AB_2066662 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616332
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality unknown
Target(s): NFYA
Proper citation: Roberto Mantovani Cat# NF-YA, RRID:AB_2616332 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616326
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality unknown
Target(s): GTF3C2
Proper citation: Robert White Cat# TFIIIC-110 4286, RRID:AB_2616326 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600104
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ERLEC1
Proper citation: Atlas Antibodies Cat# HPA031501, RRID:AB_10600104 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
