Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
R-Phycoerythrin-AffiniPure Goat Anti-Mouse IgG (subclasses1+2a+2b+3), Fc_ Fragment Specific (min X Hu,Bov,Rb Sr Prot) Resource Report Resource Website Rating or validation data |
Jackson ImmunoResearch Labs Cat# 115-115-164, RRID:AB_2338619 | Mouse IgG (subclasses1+2a+2b+3), Fc? Fragment Specific | Originating manufacturer of this product | unknown | AB_2338619 | Jackson ImmunoResearch Labs | 115-115-164 | 2025-08-19 08:52:49 | 0 | ||||
|
Anti-CHKA Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024153, RRID:AB_1846664 | CHKA | human | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1846664 | Atlas Antibodies | HPA024153 | 2025-08-19 08:53:00 | 0 | ||
|
Anti-FHOD3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024696, RRID:AB_1848573 | FHOD3 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1848573 | Sigma-Aldrich | HPA024696 | 2025-08-19 08:53:00 | 0 | ||
|
STAT5A-human Resource Report Resource Website Rating or validation data |
Santa Cruz Biotechnology Cat# sc-271542, RRID:AB_10649508 | STAT5A | homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot F0811 for not specified; status is not pursued | monoclonal | mouse | AB_10649508 | Santa Cruz Biotechnology | sc-271542 | 2025-08-19 08:53:41 | 0 | ||
|
Anti-HNRNPH2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA000914, RRID:AB_2666143 | HNRNPH2 | human | Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2666143 | Atlas Antibodies | HPA000914 | 2025-08-19 08:53:39 | 0 | ||
|
Anti-RAD18 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006724, RRID:AB_2667655 | RAD18 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2667655 | Atlas Antibodies | HPA006724 | 2025-08-19 08:53:09 | 0 | ||
|
Anti-FANK1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037557, RRID:AB_2675541 | FANK1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSP; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_2675541 | Atlas Antibodies | HPA037557 | 2025-08-19 08:53:12 | 0 | ||
|
HNRPM Antibody (against the N terminal of HNRPM) (50ug) Resource Report Resource Website 1+ mentions Rating or validation data |
Aviva Systems Biology Cat# ARP40620_P050, RRID:AB_1215871 | HNRPM (against the N terminal of HNRPM) (50ug) | chicken, rat, canine, mouse, chickenbird, dog, human | manufacturer recommendations: IgG ELISA; Western Blot; WB; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615125, AB_1215871. | polyclonal | rabbit | AB_1215871 | Aviva Systems Biology | ARP40620_P050 | 2025-08-19 08:53:44 | 1 | ||
|
Anti-NECAB1 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA023629, RRID:AB_1848014 | NECAB1 | mouse, human | Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1848014 | Atlas Antibodies | HPA023629 | 2025-08-19 08:53:11 | 3 | ||
|
Anti-RPGRIP1L antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA039405, RRID:AB_10794636 | RPGRIP1L antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10794636 | Sigma-Aldrich | HPA039405 | 2025-08-19 08:53:44 | 0 | ||
|
Pyruvate Dehydrogenase E2 Resource Report Resource Website 1+ mentions Rating or validation data |
Abcam Cat# ab110332, RRID:AB_10858998 | Porcine Pyruvate Dehydrogenase E2 protein. |
Used By NYUIHC-1089 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | AB_10858998 | Abcam | ab110332 | 2025-08-19 08:54:08 | 2 | ||||
|
Purified (azide-free) anti-TDP43 Phospho (Ser409/410) Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 829901, RRID:AB_2564934 | TDP43 Phospho Ser409/410 | rat, human | Clone 1D3/TDP-43 |
Applications: WB, IHC, ICC, ELISA Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | Rat | AB_2564934 | BioLegend | 829901 | 2025-08-19 08:53:20 | 3 | |
|
Anti-WDR78 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045793, RRID:AB_10959604 | WDR78 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10959604 | Sigma-Aldrich | HPA045793 | 2025-08-19 08:53:26 | 0 | |||
|
Anti-COG6 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040441, RRID:AB_10794030 | COG6 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10794030 | Sigma-Aldrich | HPA040441 | 2025-08-19 08:54:17 | 0 | ||
|
Anti-MOGAT3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA011940, RRID:AB_1854057 | Human MOGAT3 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854057 | Sigma-Aldrich | HPA011940 | 2025-08-19 08:53:42 | 0 | ||
|
Anti-WDR33 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046527, RRID:AB_2679686 | WDR33 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679686 | Atlas Antibodies | HPA046527 | 2025-08-19 08:54:31 | 0 | ||
|
Anti-FGF7 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043605, RRID:AB_10960215 | FGF7 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10960215 | Sigma-Aldrich | HPA043605 | 2025-08-19 08:54:07 | 0 | |||
|
Anti-NELFB polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA020259, RRID:AB_1847072 | NELFB | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1847072 | Atlas Antibodies | HPA020259 | 2025-08-19 08:54:34 | 0 | ||
|
Anti-PSMC3IP antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA044439, RRID:AB_10964210 | PSMC3IP antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10964210 | Sigma-Aldrich | HPA044439 | 2025-08-19 08:54:06 | 1 | |||
|
LTA4H-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX105239, RRID:AB_11172953 | LTA4H | human | ENCODE PROJECT External validation DATA SET is released testing lot 40723 for not specified; status is not pursued | polyclonal | rabbit | AB_11172953 | GeneTex | GTX105239 | 2025-08-19 08:54:29 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
