Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-ST8SIA1 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA026775, RRID:AB_1857534 | ST8SIA1 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1857534 | Atlas Antibodies | HPA026775 | 2025-08-19 08:59:51 | 1 | ||
|
Anti-AC005014.4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020554, RRID:AB_1859508 | AC005014.4 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1859508 | Sigma-Aldrich | HPA020554 | 2025-08-19 08:59:52 | 0 | ||
|
cerbB-2 Oncoprotein (Internal Domain) Resource Report Resource Website Discontinued Rating or validation data |
Vector Laboratories Cat# VP-C380, RRID:AB_2335909 | c-erbB-2 Oncoprotein | CB11 |
Discontinued: 2015; Discontinued on 15 July 2015 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_2335909 | Vector Laboratories | VP-C380 | 2025-08-19 09:00:26 | 0 | ||
|
Rabbit anti-GTF2IRD/TFII-IRD1 Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A301-333A, RRID:AB_937890 | GTF2IRD/TFII-IRD1 | human | Applications: WB, IP, IHC | polyclonal | rabbit | AB_937890 | Bethyl | A301-333A (also A301-333A-T, A301-333A-M) | 2025-08-19 09:00:10 | 0 | ||
|
Rabbit anti-ADNP Antibody, Affinity Purified Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Bethyl Cat# A300-104A, RRID:AB_242522 | ADNP | human | Applications: WB, IHC | polyclonal | rabbit | AB_242522 | Bethyl | A300-104A (also A300-104A-M, A300-104A-T) | 2025-08-19 09:00:34 | 2 | ||
|
Rabbit anti-WDR5 Antibody, Affinity Purified Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Bethyl Cat# A302-429A, RRID:AB_1944302 | WDR5 | human | Applications: IP, IHC | polyclonal | rabbit | AB_1944302 | Bethyl | A302-429A (also A302-429A-T) | 2025-08-19 08:56:42 | 8 | ||
|
UCP1 antibody Resource Report Resource Website 10+ mentions Rating or validation data |
Abcam Cat# ab23841, RRID:AB_2213764 | Synthetic peptide conjugated to KLH derived from within residues 100 - 200 of Human UCP1. | mouse, human |
Used By NYUIHC-1227 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE |
unknown | rabbit | AB_2213764 | Abcam | ab23841 | 2025-08-19 08:57:31 | 20 | ||
|
Vimentin Resource Report Resource Website Rating or validation data |
Leica Biosystems Cat# RTU-VIM-V9, RRID:AB_564056 | Purified vimentin from porcine eye lens. |
Used By NYUIHC-1384 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_564056 | Leica Biosystems | RTU-VIM-V9 | 2025-08-19 08:57:30 | 0 | |||
|
gro-dmelanogaster Resource Report Resource Website Rating or validation data |
Kevin White Cat# KW0:GRO, RRID:AB_2616130 | gro | drosophila melanogaster | ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization | unknown | rabbit | AB_2616130 | Kevin White | KW0:GRO (also ENCAB433UDM) | 2025-08-19 08:57:43 | 0 | ||
|
Rabbit anti-ZNF358 Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A304-090A, RRID:AB_2621339 | ZNF358 | mouse, human | Applications: WB, IP | polyclonal | rabbit | AB_2621339 | Bethyl | A304-090A (also A304-090A-T, A304-090A-M) | 2025-08-19 08:57:17 | 0 | ||
|
Anti-ZNF131 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA027748, RRID:AB_2672374 | ZNF131 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2672374 | Atlas Antibodies | HPA027748 | 2025-08-19 08:57:21 | 0 | ||
|
Anti-GAS8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048238, RRID:AB_2680324 | GAS8 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680324 | Atlas Antibodies | HPA048238 | 2025-08-19 08:57:21 | 0 | ||
|
Anti-EIF2AK3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015737, RRID:AB_1848062 | EIF2AK3 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1848062 | Sigma-Aldrich | HPA015737 | 2025-08-19 08:57:25 | 0 | ||
|
Anti-NSDHL Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA000571, RRID:AB_1079506 | NSDHL | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1079506 | Atlas Antibodies | HPA000571 | 2025-08-19 08:57:20 | 0 | ||
|
KLF11 antibody [N2C2], Internal Resource Report Resource Website Discontinued Rating or validation data |
GeneTex Cat# GTX104379, RRID:AB_2037310 | KLF11 antibody [N2C2] Internal | human | Discontinued; manufacturer recommendations: Western Blot; Suggested starting dilutions are as follows. WB: 1:500-1:3000. Not yet tested in other applications. Optimal working dilutions should be determined experimentally by the end user. Western Blot. | polyclonal | rabbit | AB_2037310 | GeneTex | GTX104379 | 2025-08-19 08:57:31 | 0 | ||
|
Anti-CD74 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA010592, RRID:AB_1078482 | CD74 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1078482 | Atlas Antibodies | HPA010592 | 2025-08-19 08:57:20 | 0 | ||
|
Anti-PLA2G3 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021016, RRID:AB_1855443 | PLA2G3 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1855443 | Atlas Antibodies | HPA021016 | 2025-08-19 08:57:21 | 0 | ||
|
Anti-RWDD2A Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA030105, RRID:AB_10599826 | RWDD2A | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10599826 | Atlas Antibodies | HPA030105 | 2025-08-19 08:57:44 | 0 | ||
|
Anti-RAB31 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA019717, RRID:AB_10601493 | RAB31 | Human, Rat, Mouse | Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10601493 | Atlas Antibodies | HPA019717 | 2025-08-19 08:57:21 | 0 | ||
|
Anti-DIXDC1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA039424, RRID:AB_2676500 | DIXDC1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQSNGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGIS; Manufacturer approved use: ICC-IF, WB | polyclonal | rabbit | AB_2676500 | Atlas Antibodies | HPA039424 | 2025-08-19 08:57:21 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
