Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857534
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ST8SIA1
Proper citation: Atlas Antibodies Cat# HPA026775, RRID:AB_1857534 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859508
Comments: Vendor recommendations: Other; Western Blot; Immunofluorescence; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): AC005014.4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020554, RRID:AB_1859508 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335909
Comments: Discontinued: 2015; Discontinued on 15 July 2015
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): c-erbB-2 Oncoprotein
Proper citation: Vector Laboratories Cat# VP-C380, RRID:AB_2335909 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_937890
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): GTF2IRD/TFII-IRD1
Proper citation: Bethyl Cat# A301-333A, RRID:AB_937890 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_242522
Comments: Applications: WB, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ADNP
Proper citation: Bethyl Cat# A300-104A, RRID:AB_242522 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1944302
Comments: Applications: IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR5
Proper citation: Bethyl Cat# A302-429A, RRID:AB_1944302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2213764
Comments: Used By NYUIHC-1227
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality unknown
Target(s): Synthetic peptide conjugated to KLH derived from within residues 100 - 200 of Human UCP1.
Proper citation: Abcam Cat# ab23841, RRID:AB_2213764 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_564056
Comments: Used By NYUIHC-1384
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality monoclonal
Target(s): Purified vimentin from porcine eye lens.
Proper citation: Leica Biosystems Cat# RTU-VIM-V9, RRID:AB_564056 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616130
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): gro
Proper citation: Kevin White Cat# KW0:GRO, RRID:AB_2616130 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2621339
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF358
Proper citation: Bethyl Cat# A304-090A, RRID:AB_2621339 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672374
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF131
Proper citation: Atlas Antibodies Cat# HPA027748, RRID:AB_2672374 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680324
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GAS8
Proper citation: Atlas Antibodies Cat# HPA048238, RRID:AB_2680324 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848062
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): EIF2AK3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015737, RRID:AB_1848062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079506
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): NSDHL
Proper citation: Atlas Antibodies Cat# HPA000571, RRID:AB_1079506 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2037310
Comments: Discontinued; manufacturer recommendations: Western Blot; Suggested starting dilutions are as follows. WB: 1:500-1:3000. Not yet tested in other applications. Optimal working dilutions should be determined experimentally by the end user. Western Blot.
Host Organism: rabbit
Clonality polyclonal
Target(s): KLF11 antibody [N2C2] Internal
Proper citation: GeneTex Cat# GTX104379, RRID:AB_2037310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078482
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CD74
Proper citation: Atlas Antibodies Cat# HPA010592, RRID:AB_1078482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855443
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PLA2G3
Proper citation: Atlas Antibodies Cat# HPA021016, RRID:AB_1855443 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599826
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): RWDD2A
Proper citation: Atlas Antibodies Cat# HPA030105, RRID:AB_10599826 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601493
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAB31
Proper citation: Atlas Antibodies Cat# HPA019717, RRID:AB_10601493 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676500
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQSNGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGIS; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): DIXDC1
Proper citation: Atlas Antibodies Cat# HPA039424, RRID:AB_2676500 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.