Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 134 showing 2661 ~ 2680 out of 55,391 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960395

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): C2orf56 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045217, RRID:AB_10960395 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_940872

Comments: validation status unknown, seller recommendations provided in 2012: Western Blot; Western Blot
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): CD274

Proper citation: Abcam Cat# ab58810, RRID:AB_940872 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2221026

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZSCAN22

Proper citation: Atlas Antibodies Cat# HPA006471, RRID:AB_2221026 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080455

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): UCKL1

Proper citation: Atlas Antibodies Cat# HPA004722, RRID:AB_1080455 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079073

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HMGXB4

Proper citation: Atlas Antibodies Cat# HPA000725, RRID:AB_1079073 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794889

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): C8orf44

Proper citation: Atlas Antibodies Cat# HPA043660, RRID:AB_10794889 Copy   

    • RRID:AB_10672402

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672402

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FAM208B

Proper citation: Atlas Antibodies Cat# HPA038043, RRID:AB_10672402 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10968057

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF442

Proper citation: Atlas Antibodies Cat# HPA045738, RRID:AB_10968057 Copy   

    • RRID:AB_2683386

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683386

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RRM1

Proper citation: Atlas Antibodies Cat# HPA057265, RRID:AB_2683386 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681292

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): H2AFY

Proper citation: Atlas Antibodies Cat# HPA050962, RRID:AB_2681292 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680087

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): IFNA6

Proper citation: Atlas Antibodies Cat# HPA047557, RRID:AB_2680087 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685410

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CEBPA

Proper citation: Atlas Antibodies Cat# HPA065037, RRID:AB_2685410 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10603142

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VN1R4

Proper citation: Atlas Antibodies Cat# HPA027018, RRID:AB_10603142 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684311

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1161

Proper citation: Atlas Antibodies Cat# HPA060533, RRID:AB_2684311 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686512

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNC; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): CAPN5

Proper citation: Atlas Antibodies Cat# HPA072319, RRID:AB_2686512 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2679989

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC144A

Proper citation: Atlas Antibodies Cat# HPA047220, RRID:AB_2679989 Copy   

    • RRID:AB_1858084

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858084

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TMEM126B

Proper citation: Atlas Antibodies Cat# HPA019186, RRID:AB_1858084 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682055

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SNAPC3

Proper citation: Atlas Antibodies Cat# HPA053145, RRID:AB_2682055 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682973

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LINGO3

Proper citation: Atlas Antibodies Cat# HPA055932, RRID:AB_2682973 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2670615

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): NLRP2

Proper citation: Atlas Antibodies Cat# HPA021183, RRID:AB_2670615 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web.  We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.

Recent News Entries

Recommendations for repositories and scientific gateways from a neuroscience perspective

NEURON course at the CNS meeting

Neuron Course this year has just been announced!

Contact Us

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch