Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Mentions:yes (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

141,647 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
CD86-PE, human
 
Resource Report
Resource Website
1+ mentions
Discontinued
Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 CD86 non-human primate, human FM95 Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity:
Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843).
monoclonal mouse AB_10839702 Miltenyi Biotec 130-094-877 2025-08-19 09:29:52 2
Anti-OTUD3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 OTUD3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB polyclonal rabbit AB_10599302 Atlas Antibodies HPA028543 2025-08-19 09:29:51 1
Alexa Fluor(R) 647 anti-human TRA-1-60-R
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
BioLegend Cat# 330606, RRID:AB_1227812 TRA-1-60-R human Clone TRA-1-60-R Applications: FC monoclonal mouse AB_1227812 BioLegend 330606 (also 330605) 2025-08-19 09:29:52 7
Mouse Anti-Gab 1 Monoclonal Antibody, Unconjugated
 
Resource Report
Resource Website
1+ mentions
Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Gab1 rat, mouse, human validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry monoclonal mouse AB_2107855 Santa Cruz Biotechnology sc-133191 2025-08-19 09:29:29 3
Alexa Fluor(R) 488 anti-human CD107a (LAMP-1)
 
Resource Report
Resource Website
1+ mentions
BioLegend Cat# 328610, RRID:AB_1227504 CD107a human Clone H4A3 Applications: FC monoclonal mouse AB_1227504 BioLegend 328610 (also 328609) 2025-08-19 09:29:52 3
PE anti-human CD107a (LAMP-1)
 
Resource Report
Resource Website
10+ mentions
BioLegend Cat# 328608, RRID:AB_1186040 CD107a human Clone H4A3 Applications: FC monoclonal mouse AB_1186040 BioLegend 328608 (also 328607) 2025-08-19 09:29:25 19
CD239
 
Resource Report
Resource Website
1+ mentions
Abcam Cat# 2994-1, RRID:AB_2065309 BCAM human validation status unknown, seller recommendations provided in 2012:immunohistochemistry, immunocytochemistry monoclonal rabbit AB_2065309 Abcam 2994-1 2025-08-19 09:29:27 1
SERCA2a pAb serum
 
Resource Report
Resource Website
1+ mentions
Badrilla Cat# A010-20, RRID:AB_2631042 SERCA2a rat, cow, mouse, rabbit, dog, human polyclonal rabbit AB_2631042 Badrilla A010-20 2025-08-19 09:29:39 2
vGluT (Drosophila vesicular glutamate transporter)
 
Resource Report
Resource Website
1+ mentions
H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany Cat# vGluT (Drosophila vesicular glutamate transporter), RRID:AB_2315544 PMID:18205208 unknown AB_2315544 H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany vGluT (Drosophila vesicular glutamate transporter) 2025-08-19 09:29:36 3
CYP3A4 antibody [3H8]
 
Resource Report
Resource Website
1+ mentions
GeneTex Cat# GTX60577, RRID:AB_2887981 human Applications: WB, ICC/IF, IHC-P, FACS, ELISA monoclonal mouse AB_2887981 GeneTex GTX60577 2025-08-19 09:29:41 1
Biotin anti-mouse CD31
 
Resource Report
Resource Website
10+ mentions
BioLegend Cat# 102504, RRID:AB_312911 CD31 mouse Clone MEC13.3 Applications: FC monoclonal rat AB_312911 BioLegend 102504 (also 102503) 2025-08-19 09:29:42 10
Mouse Anti-MIP-1 beta Monoclonal Antibody, Phycoerythrin Conjugated, Clone D21-1351
 
Resource Report
Resource Website
10+ mentions
BD Biosciences Cat# 550078, RRID:AB_393549 MIP-1 beta human D21-1351 Intracellular staining (flow Cytotoxicityometry) monoclonal mouse AB_393549 BD Biosciences 550078 2025-08-19 09:29:38 33
PMCA2
 
Resource Report
Resource Website
1+ mentions
Peter Barr-Gillespie - Oregon Health and Science University Cat# Barr-Gillespie_PMCA2, RRID:AB_2630386 plasma membrane calcium ATPase isoform 2 (PMCA2) PMID:11438582 polyclonal rabbit AB_2630386 Peter Barr-Gillespie - Oregon Health and Science University Barr-Gillespie_PMCA2 2025-08-19 09:29:57 1
Rabbit Anti-MGluR2 Polyclonal antibody, Unconjugated
 
Resource Report
Resource Website
1+ mentions
Millipore Cat# 07-261, RRID:AB_2116167 mGluR2 rat seller recommendations: Western Blot; Western Blotting polyclonal rabbit AB_2116167 Millipore 07-261 2025-08-19 09:29:55 2
Anti-SYF2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA070710, RRID:AB_2686301 SYF2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686301 Atlas Antibodies HPA070710 2025-08-19 09:29:40 1
α-Tubulin mouse monoclonal antibody
 
Resource Report
Resource Website
1+ mentions
Tianjin Sungene Biotech Cat# KM9007, RRID:AB_2920560 α-Tubulin rat, mouse, human 17G7 Applications: WB monoclonal mouse AB_2920560 Tianjin Sungene Biotech KM9007 2025-08-19 09:29:41 1
Rabbit anti-SF3B4 Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A303-950A, RRID:AB_2620299 SF3B4 mouse, human Applications: WB, IP, IHC polyclonal rabbit AB_2620299 Bethyl A303-950A (also A303-950A-M, A303-950A-T) 2025-08-19 09:29:39 3
C-Peptide Kit
 
Resource Report
Resource Website
1+ mentions
Siemens Cat# LKPEP1, RRID:AB_2757817 C-Peptide human unknown mouse AB_2757817 Siemens LKPEP1 2025-08-19 09:29:57 1
CD45-VioGreen
 
Resource Report
Resource Website
1+ mentions
Discontinued
Miltenyi Biotec Cat# 130-102-776, RRID:AB_2659926 CD45 mouse 30F11 Discontinued: 7-2019; Target Distribution B cells, basophils, dendritic cells, granulocytes, hematopoietic stem cells, Langerhans cells, leukocytes, lymphocytes, macrophages, mast cells, monocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL monoclonal rat AB_2659926 Miltenyi Biotec 130-102-776 2025-08-19 09:29:57 1
Claudin 5 Antibody
 
Resource Report
Resource Website
1+ mentions
Proteintech Cat# 29767-1-AP, RRID:AB_2935477 Claudin 5 rat, mouse, human Applications: WB, IHC, IF, ELISA polyclonal rabbit AB_2935477 Proteintech 29767-1-AP 2025-08-19 09:29:57 1

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.