Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
CD86-PE, human Resource Report Resource Website 1+ mentions Discontinued |
Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 | CD86 | non-human primate, human | FM95 |
Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity: Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843). |
monoclonal | mouse | AB_10839702 | Miltenyi Biotec | 130-094-877 | 2025-08-19 09:29:52 | 2 | |
|
Anti-OTUD3 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 | OTUD3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB | polyclonal | rabbit | AB_10599302 | Atlas Antibodies | HPA028543 | 2025-08-19 09:29:51 | 1 | ||
|
Alexa Fluor(R) 647 anti-human TRA-1-60-R Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 330606, RRID:AB_1227812 | TRA-1-60-R | human | Clone TRA-1-60-R | Applications: FC | monoclonal | mouse | AB_1227812 | BioLegend | 330606 (also 330605) | 2025-08-19 09:29:52 | 7 | |
|
Mouse Anti-Gab 1 Monoclonal Antibody, Unconjugated Resource Report Resource Website 1+ mentions |
Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 | Gab1 | rat, mouse, human | validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry | monoclonal | mouse | AB_2107855 | Santa Cruz Biotechnology | sc-133191 | 2025-08-19 09:29:29 | 3 | ||
|
Alexa Fluor(R) 488 anti-human CD107a (LAMP-1) Resource Report Resource Website 1+ mentions |
BioLegend Cat# 328610, RRID:AB_1227504 | CD107a | human | Clone H4A3 | Applications: FC | monoclonal | mouse | AB_1227504 | BioLegend | 328610 (also 328609) | 2025-08-19 09:29:52 | 3 | |
|
PE anti-human CD107a (LAMP-1) Resource Report Resource Website 10+ mentions |
BioLegend Cat# 328608, RRID:AB_1186040 | CD107a | human | Clone H4A3 | Applications: FC | monoclonal | mouse | AB_1186040 | BioLegend | 328608 (also 328607) | 2025-08-19 09:29:25 | 19 | |
|
CD239 Resource Report Resource Website 1+ mentions |
Abcam Cat# 2994-1, RRID:AB_2065309 | BCAM | human | validation status unknown, seller recommendations provided in 2012:immunohistochemistry, immunocytochemistry | monoclonal | rabbit | AB_2065309 | Abcam | 2994-1 | 2025-08-19 09:29:27 | 1 | ||
|
SERCA2a pAb serum Resource Report Resource Website 1+ mentions |
Badrilla Cat# A010-20, RRID:AB_2631042 | SERCA2a | rat, cow, mouse, rabbit, dog, human | polyclonal | rabbit | AB_2631042 | Badrilla | A010-20 | 2025-08-19 09:29:39 | 2 | |||
|
vGluT (Drosophila vesicular glutamate transporter) Resource Report Resource Website 1+ mentions |
H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany Cat# vGluT (Drosophila vesicular glutamate transporter), RRID:AB_2315544 | PMID:18205208 | unknown | AB_2315544 | H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany | vGluT (Drosophila vesicular glutamate transporter) | 2025-08-19 09:29:36 | 3 | |||||
|
CYP3A4 antibody [3H8] Resource Report Resource Website 1+ mentions |
GeneTex Cat# GTX60577, RRID:AB_2887981 | human | Applications: WB, ICC/IF, IHC-P, FACS, ELISA | monoclonal | mouse | AB_2887981 | GeneTex | GTX60577 | 2025-08-19 09:29:41 | 1 | |||
|
Biotin anti-mouse CD31 Resource Report Resource Website 10+ mentions |
BioLegend Cat# 102504, RRID:AB_312911 | CD31 | mouse | Clone MEC13.3 | Applications: FC | monoclonal | rat | AB_312911 | BioLegend | 102504 (also 102503) | 2025-08-19 09:29:42 | 10 | |
|
Mouse Anti-MIP-1 beta Monoclonal Antibody, Phycoerythrin Conjugated, Clone D21-1351 Resource Report Resource Website 10+ mentions |
BD Biosciences Cat# 550078, RRID:AB_393549 | MIP-1 beta | human | D21-1351 | Intracellular staining (flow Cytotoxicityometry) | monoclonal | mouse | AB_393549 | BD Biosciences | 550078 | 2025-08-19 09:29:38 | 33 | |
|
PMCA2 Resource Report Resource Website 1+ mentions |
Peter Barr-Gillespie - Oregon Health and Science University Cat# Barr-Gillespie_PMCA2, RRID:AB_2630386 | plasma membrane calcium ATPase isoform 2 (PMCA2) | PMID:11438582 | polyclonal | rabbit | AB_2630386 | Peter Barr-Gillespie - Oregon Health and Science University | Barr-Gillespie_PMCA2 | 2025-08-19 09:29:57 | 1 | |||
|
Rabbit Anti-MGluR2 Polyclonal antibody, Unconjugated Resource Report Resource Website 1+ mentions |
Millipore Cat# 07-261, RRID:AB_2116167 | mGluR2 | rat | seller recommendations: Western Blot; Western Blotting | polyclonal | rabbit | AB_2116167 | Millipore | 07-261 | 2025-08-19 09:29:55 | 2 | ||
|
Anti-SYF2 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA070710, RRID:AB_2686301 | SYF2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686301 | Atlas Antibodies | HPA070710 | 2025-08-19 09:29:40 | 1 | ||
|
α-Tubulin mouse monoclonal antibody Resource Report Resource Website 1+ mentions |
Tianjin Sungene Biotech Cat# KM9007, RRID:AB_2920560 | α-Tubulin | rat, mouse, human | 17G7 | Applications: WB | monoclonal | mouse | AB_2920560 | Tianjin Sungene Biotech | KM9007 | 2025-08-19 09:29:41 | 1 | |
|
Rabbit anti-SF3B4 Antibody, Affinity Purified Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Bethyl Cat# A303-950A, RRID:AB_2620299 | SF3B4 | mouse, human | Applications: WB, IP, IHC | polyclonal | rabbit | AB_2620299 | Bethyl | A303-950A (also A303-950A-M, A303-950A-T) | 2025-08-19 09:29:39 | 3 | ||
|
C-Peptide Kit Resource Report Resource Website 1+ mentions |
Siemens Cat# LKPEP1, RRID:AB_2757817 | C-Peptide | human | unknown | mouse | AB_2757817 | Siemens | LKPEP1 | 2025-08-19 09:29:57 | 1 | |||
|
CD45-VioGreen Resource Report Resource Website 1+ mentions Discontinued |
Miltenyi Biotec Cat# 130-102-776, RRID:AB_2659926 | CD45 | mouse | 30F11 | Discontinued: 7-2019; Target Distribution B cells, basophils, dendritic cells, granulocytes, hematopoietic stem cells, Langerhans cells, leukocytes, lymphocytes, macrophages, mast cells, monocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL | monoclonal | rat | AB_2659926 | Miltenyi Biotec | 130-102-776 | 2025-08-19 09:29:57 | 1 | |
|
Claudin 5 Antibody Resource Report Resource Website 1+ mentions |
Proteintech Cat# 29767-1-AP, RRID:AB_2935477 | Claudin 5 | rat, mouse, human | Applications: WB, IHC, IF, ELISA | polyclonal | rabbit | AB_2935477 | Proteintech | 29767-1-AP | 2025-08-19 09:29:57 | 1 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.