Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 132 showing 2621 ~ 2640 out of 141,647 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_10839702

    This resource has 1+ mentions.

Discontinued

http://antibodyregistry.org/AB_10839702

Comments: Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity:
Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843).
Host Organism: mouse
Clonality monoclonal
Target(s): CD86

Proper citation: Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 Copy   


  • RRID:AB_10599302

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10599302

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): OTUD3

Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1227812

Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): TRA-1-60-R

Proper citation: BioLegend Cat# 330606, RRID:AB_1227812 Copy   


http://antibodyregistry.org/AB_2107855

Comments: validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry
Host Organism: mouse
Clonality monoclonal
Target(s): Gab1

Proper citation: Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Copy   


http://antibodyregistry.org/AB_1227504

Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): CD107a

Proper citation: BioLegend Cat# 328610, RRID:AB_1227504 Copy   


  • RRID:AB_1186040

    This resource has 10+ mentions.

http://antibodyregistry.org/AB_1186040

Comments: Applications: FC
Host Organism: mouse
Clonality monoclonal
Target(s): CD107a

Proper citation: BioLegend Cat# 328608, RRID:AB_1186040 Copy   


  • RRID:AB_2065309

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2065309

Comments: validation status unknown, seller recommendations provided in 2012:immunohistochemistry, immunocytochemistry
Host Organism: rabbit
Clonality monoclonal
Target(s): BCAM

Proper citation: Abcam Cat# 2994-1, RRID:AB_2065309 Copy   


  • RRID:AB_2631042

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2631042

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): SERCA2a

Proper citation: Badrilla Cat# A010-20, RRID:AB_2631042 Copy   


http://antibodyregistry.org/AB_2315544

Comments:
Host Organism:
Clonality unknown
Target(s):

Proper citation: H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany Cat# vGluT (Drosophila vesicular glutamate transporter), RRID:AB_2315544 Copy   


  • RRID:AB_2887981

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2887981

Comments: Applications: WB, ICC/IF, IHC-P, FACS, ELISA
Host Organism: mouse
Clonality monoclonal
Target(s):

Proper citation: GeneTex Cat# GTX60577, RRID:AB_2887981 Copy   


  • RRID:AB_312911

    This resource has 10+ mentions.

http://antibodyregistry.org/AB_312911

Comments: Applications: FC
Host Organism: rat
Clonality monoclonal
Target(s): CD31

Proper citation: BioLegend Cat# 102504, RRID:AB_312911 Copy   


http://antibodyregistry.org/AB_393549

Comments: Intracellular staining (flow Cytotoxicityometry)
Host Organism: mouse
Clonality monoclonal
Target(s): MIP-1 beta

Proper citation: BD Biosciences Cat# 550078, RRID:AB_393549 Copy   


  • RRID:AB_2630386

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2630386

Comments:
Host Organism: rabbit
Clonality polyclonal
Target(s): plasma membrane calcium ATPase isoform 2 (PMCA2)

Proper citation: Peter Barr-Gillespie - Oregon Health and Science University Cat# Barr-Gillespie_PMCA2, RRID:AB_2630386 Copy   


http://antibodyregistry.org/AB_2116167

Comments: seller recommendations: Western Blot; Western Blotting
Host Organism: rabbit
Clonality polyclonal
Target(s): mGluR2

Proper citation: Millipore Cat# 07-261, RRID:AB_2116167 Copy   


  • RRID:AB_2686301

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686301

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SYF2

Proper citation: Atlas Antibodies Cat# HPA070710, RRID:AB_2686301 Copy   


  • RRID:AB_2920560

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2920560

Comments: Applications: WB
Host Organism: mouse
Clonality monoclonal
Target(s): α-Tubulin

Proper citation: Tianjin Sungene Biotech Cat# KM9007, RRID:AB_2920560 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2620299

Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): SF3B4

Proper citation: Bethyl Cat# A303-950A, RRID:AB_2620299 Copy   


  • RRID:AB_2757817

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2757817

Comments:
Host Organism: mouse
Clonality unknown
Target(s): C-Peptide

Proper citation: Siemens Cat# LKPEP1, RRID:AB_2757817 Copy   


  • RRID:AB_2659926

    This resource has 1+ mentions.

Discontinued

http://antibodyregistry.org/AB_2659926

Comments: Discontinued: 7-2019; Target Distribution B cells, basophils, dendritic cells, granulocytes, hematopoietic stem cells, Langerhans cells, leukocytes, lymphocytes, macrophages, mast cells, monocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL
Host Organism: rat
Clonality monoclonal
Target(s): CD45

Proper citation: Miltenyi Biotec Cat# 130-102-776, RRID:AB_2659926 Copy   


  • RRID:AB_2935477

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2935477

Comments: Applications: WB, IHC, IF, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): Claudin 5

Proper citation: Proteintech Cat# 29767-1-AP, RRID:AB_2935477 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X