Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603142
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): VN1R4
Proper citation: Atlas Antibodies Cat# HPA027018, RRID:AB_10603142 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684311
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KIAA1161
Proper citation: Atlas Antibodies Cat# HPA060533, RRID:AB_2684311 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686512
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNC; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality polyclonal
Target(s): CAPN5
Proper citation: Atlas Antibodies Cat# HPA072319, RRID:AB_2686512 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679989
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCDC144A
Proper citation: Atlas Antibodies Cat# HPA047220, RRID:AB_2679989 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858084
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): TMEM126B
Proper citation: Atlas Antibodies Cat# HPA019186, RRID:AB_1858084 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682055
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SNAPC3
Proper citation: Atlas Antibodies Cat# HPA053145, RRID:AB_2682055 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682973
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LINGO3
Proper citation: Atlas Antibodies Cat# HPA055932, RRID:AB_2682973 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_312746
Comments: Applications: FC
Host Organism: rat
Clonality monoclonal
Target(s): CD8alpha
Proper citation: BioLegend Cat# 100707, RRID:AB_312746 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079677
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PRKG1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007699, RRID:AB_1079677 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078493
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): CDK9 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006738, RRID:AB_1078493 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845722
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): TXNDC15 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015483, RRID:AB_1845722 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600000
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): C6orf62 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030564, RRID:AB_10600000 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600654
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ANKRD13C antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026725, RRID:AB_10600654 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852474
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): KIF1B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026434, RRID:AB_1852474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852082
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): KAZALD1
Proper citation: Atlas Antibodies Cat# HPA011800, RRID:AB_1852082 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10797383
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FUZ
Proper citation: Atlas Antibodies Cat# HPA042196, RRID:AB_10797383 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599997
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): LURAP1
Proper citation: Atlas Antibodies Cat# HPA030060, RRID:AB_10599997 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673159
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): KCNE2
Proper citation: Sigma-Aldrich Cat# HPA029706, RRID:AB_2673159 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675783
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): DYDC2
Proper citation: Sigma-Aldrich Cat# HPA038007, RRID:AB_2675783 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677691
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CD177
Proper citation: Atlas Antibodies Cat# HPA041820, RRID:AB_2677691 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
