Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846979
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human CLPS
Proper citation: Sigma-Aldrich Cat# HPA010512, RRID:AB_1846979 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848750
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human HEATR2
Proper citation: Sigma-Aldrich Cat# HPA020243, RRID:AB_1848750 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851277
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human KAT5
Proper citation: Sigma-Aldrich Cat# HPA016953, RRID:AB_1851277 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851499
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human IGFBP6
Proper citation: Sigma-Aldrich Cat# HPA008005, RRID:AB_1851499 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854490
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human PPP1R8
Proper citation: Sigma-Aldrich Cat# HPA027452, RRID:AB_1854490 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857692
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Western Blot; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SYNJ1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011916, RRID:AB_1857692 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855118
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PDE1A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022151, RRID:AB_1855118 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858091
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human TMEM140
Proper citation: Sigma-Aldrich Cat# HPA016871, RRID:AB_1858091 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10562487
Comments: Applications: Immunohistochemistry, Immunoprecipitation, Immunocytochemistry, Western Blot, Immunofluorescence, Immunohistochemistry - fixed, ICC/IF, IHC-P, IP, WB
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4730953
Host Organism: rabbit
Clonality monoclonal
Target(s): Peroxiredoxin 6 antibody [EPR3755]
Proper citation: Abcam Cat# ab92322, RRID:AB_10562487 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854254
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): MYO1G
Proper citation: Atlas Antibodies Cat# HPA021252, RRID:AB_1854254 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846221
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): IDO1
Proper citation: Atlas Antibodies Cat# HPA023149, RRID:AB_1846221 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854087
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): MPP3
Proper citation: Atlas Antibodies Cat# HPA024742, RRID:AB_1854087 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611821
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CRISPLD2
Proper citation: Atlas Antibodies Cat# HPA030055, RRID:AB_10611821 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848575
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FMNL3
Proper citation: Atlas Antibodies Cat# HPA023201, RRID:AB_1848575 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600819
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): KLF15
Proper citation: Atlas Antibodies Cat# HPA028866, RRID:AB_10600819 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078796
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FADS2
Proper citation: Atlas Antibodies Cat# HPA006741, RRID:AB_1078796 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2665991
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): SLITRK4
Proper citation: Atlas Antibodies Cat# HPA000431, RRID:AB_2665991 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670428
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CRISP1
Proper citation: Atlas Antibodies Cat# HPA028445, RRID:AB_10670428 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_999692
Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), IHC (1:250-1:2,000), IF (1:250-1:2,000)
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF295
Proper citation: Thermo Fisher Scientific Cat# A301-528A, RRID:AB_999692 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2622233
Comments: Purified PGP 9.5 isolated from bovine brain used as immunogen. Original Manufacturer: Dako. Now part of Agilent.
Host Organism: rabbit
Clonality polyclonal
Target(s): PGP9.5
Proper citation: Agilent Cat# Z5116, RRID:AB_2622233 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
