Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Human/Mouse P-Cadherin PE-conjugated Antibody Resource Report Resource Website 1+ mentions |
R and D Systems Cat# FAB761P, RRID:AB_2291533 | P-Cadherin | mouse | 106020 | Applications: Flow Cytometry | monoclonal | Rat | AB_2291533 | R and D Systems | FAB761P | 2025-08-19 09:29:33 | 2 | |
|
BubR1 antibody [8G1] Resource Report Resource Website 1+ mentions |
Abcam Cat# ab4637, RRID:AB_2066074 | BubR1 antibody [8G1] | human | validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunofluorescence; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; Immunoprecipitation; ICC, ICC/IF, IHC-P, IP, WB | monoclonal | mouse | AB_2066074 | Abcam | ab4637 | 2025-08-19 09:28:50 | 1 | ||
|
Nup96 (C-20) Resource Report Resource Website 1+ mentions Discontinued |
Santa Cruz Biotechnology Cat# sc-27400, RRID:AB_677310 | Nup96 (C-20) | rat, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA | polyclonal | goat | AB_677310 | Santa Cruz Biotechnology | sc-27400 | 2025-08-19 09:28:55 | 1 | ||
|
gamma Tubulin (C-20) Resource Report Resource Website 1+ mentions Discontinued |
Santa Cruz Biotechnology Cat# sc-7396, RRID:AB_2211262 | gamma Tubulin (C-20) | rat, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: WB, IP, IF, IHC(P), ELISA; Immunofluorescence; ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunocytochemistry | polyclonal | goat | AB_2211262 | Santa Cruz Biotechnology | sc-7396 | 2025-08-19 09:29:33 | 7 | ||
|
TIE2 Resource Report Resource Website 1+ mentions |
BD Biosciences Cat# 557039, RRID:AB_396562 | TIE2 (CD202b) | mouse, human | Applications: Western blot, Immunohistochemistry-frozen | monoclonal | mouse | AB_396562 | BD Biosciences | 557039 | 2025-08-19 09:28:53 | 1 | ||
|
Anti-BNIP3L antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA015652, RRID:AB_1845406 | BNIP3L antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Immunofluorescence; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1845406 | Sigma-Aldrich | HPA015652 | 2025-08-19 09:29:35 | 2 | ||
|
Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb Resource Report Resource Website 1+ mentions |
Cell Signaling Technology Cat# 3505, RRID:AB_2298971 | Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb | c, rat, h, hr, m, horse, mouse, r, human, mk | Applications: W, IP, IHC-P, IF-IC. Consolidation on 11/2018: AB_10363754, AB_2156885, AB_2298971. | monoclonal | rabbit | AB_2298971 | Cell Signaling Technology | 3505 | 2025-08-19 09:29:34 | 3 | ||
|
CD324 (E-Cadherin) Monoclonal Antibody (DECMA-1), eFluor™ 660, eBioscience Resource Report Resource Website 1+ mentions |
Thermo Fisher Scientific Cat# 50-3249-80, RRID:AB_11043137 | CD324 (E-Cadherin) | canine, mouse, human | Clone DECMA-1 |
PMID:2419126 PMID:11329369 |
Applications: Flow, ICC/IF | monoclonal | rat | AB_11043137 | Thermo Fisher Scientific | 50-3249-80 (also 50-3249) | 2025-08-19 09:29:08 | 1 |
|
Anti-ATF4 Resource Report Resource Website 1+ mentions |
LSBio (LifeSpan) Cat# LS-B6361-50, RRID:AB_11042790 | ATF4 | rat, mouse, human | vendor suggested use: IgG; IgG ELISA (1:20000), IHC-P (2 µg/ml), WB (1:500); Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; ELISA | polyclonal | rabbit | AB_11042790 | LSBio (LifeSpan) | LS-B6361-50 | 2025-08-19 09:29:08 | 1 | ||
|
Mouse IgG2a kappa Isotype Control (eBM2a), eFluor™ 450, eBioscience Resource Report Resource Website 1+ mentions |
Thermo Fisher Scientific Cat# 48-4724-82, RRID:AB_1272006 | Mouse IgG2a kappa | not applicable | Clone eBM2a | Applications: Flow (Assay-Dependent), Ctrl (Assay-Dependent) | isotype control | mouse | AB_1272006 | Thermo Fisher Scientific | 48-4724-82 | 2025-08-19 09:29:40 | 1 | |
|
Anti-NSD1 Antibody Resource Report Resource Website 1+ mentions |
Antibodies Incorporated Cat# 75-280, RRID:AB_11001827 | NSD1 | mouse, human | N312/10 |
Applications: ICC Validation status: IF or IB (Pass), IB in brain (ND), IHC in brain (ND), KO (ND) This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-280, RRID:AB_11001827), supernatant (Antibodies Incorporated, Cat# 73-280, RRID:AB_11030251), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N312/10, RRID:AB_2877552) |
monoclonal | mouse | AB_11001827 | Antibodies Incorporated | 75-280 | 2025-08-19 09:29:05 | 3 | |
|
Aggrecan ARGxx antibody [BC-3] Resource Report Resource Website 1+ mentions Rating or validation data |
Abcam Cat# ab3773, RRID:AB_304066 | Aggrecan ARGxx antibody [BC-3] | feline, rat, porcine, canine, cow, pig, horse, rabbit, cat, bovine, human, dog, sheep |
validation status unknown, seller recommendations provided in 2012: ELISA, IHC-Fr, IHC-P, sELISA, WB; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed; Western Blot; Immunohistochemistry Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | mouse | AB_304066 | Abcam | ab3773 | 2025-08-19 09:29:19 | 2 | ||
|
CD28 Resource Report Resource Website 1+ mentions |
BD Biosciences Cat# 561368, RRID:AB_11154032 | CD28 | human | Applications: Flow cytometry | monoclonal | mouse | AB_11154032 | BD Biosciences | 561368 | 2025-08-19 09:29:46 | 2 | ||
|
CD183 Resource Report Resource Website 1+ mentions |
BD Biosciences Cat# 562266, RRID:AB_11153500 | CD183 (CXCR3) | mouse | Applications: Flow cytometry | monoclonal | armenian hamster | AB_11153500 | BD Biosciences | 562266 | 2025-08-19 09:29:46 | 2 | ||
|
Recombinant Anti-TOMM40 antibody [EPR6932(2)] Resource Report Resource Website 1+ mentions |
Abcam Cat# ab185543, RRID:AB_3095412 | TOMM40 | human | EPR6932(2) | Applications: Flow Cyt (Intra), WB, IHC-P, ICC/IF, IP | recombinant monoclonal | Rabbit | AB_3095412 | Abcam | ab185543 | 2025-08-19 09:29:47 | 1 | |
|
INS antibody Resource Report Resource Website 1+ mentions |
Proteintech Cat# 15848-1-AP, RRID:AB_10597100 | INS | rat, mouse, human |
Originating manufacturer of this product. Applications: IHC, IF, ELISA |
polyclonal | rabbit | AB_10597100 | Proteintech | 15848-1-AP | 2025-08-19 09:29:51 | 4 | ||
|
CD86-PE, human Resource Report Resource Website 1+ mentions Discontinued |
Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 | CD86 | non-human primate, human | FM95 |
Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity: Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843). |
monoclonal | mouse | AB_10839702 | Miltenyi Biotec | 130-094-877 | 2025-08-19 09:29:52 | 2 | |
|
Anti-OTUD3 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 | OTUD3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB | polyclonal | rabbit | AB_10599302 | Atlas Antibodies | HPA028543 | 2025-08-19 09:29:51 | 1 | ||
|
Alexa Fluor(R) 647 anti-human TRA-1-60-R Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 330606, RRID:AB_1227812 | TRA-1-60-R | human | Clone TRA-1-60-R | Applications: FC | monoclonal | mouse | AB_1227812 | BioLegend | 330606 (also 330605) | 2025-08-19 09:29:52 | 7 | |
|
Mouse Anti-Gab 1 Monoclonal Antibody, Unconjugated Resource Report Resource Website 1+ mentions |
Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 | Gab1 | rat, mouse, human | validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry | monoclonal | mouse | AB_2107855 | Santa Cruz Biotechnology | sc-133191 | 2025-08-19 09:29:29 | 3 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
